Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02450 322 / 7e-109 NAC LOV1, ANAC034, ANAC035 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) AT5G39820 190 / 6e-58 NAC ANAC094 NAC domain containing protein 94 (.1) AT1G26870 190 / 5e-57 NAC FEZ, ANAC009 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G77450 184 / 2e-56 NAC ANAC032 NAC domain containing protein 32 (.1) AT2G17040 184 / 4e-56 NAC ANAC036 NAC domain containing protein 36 (.1) AT1G01720 181 / 8e-55 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT4G27410 180 / 1e-54 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT3G15500 180 / 2e-54 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1) AT1G52890 180 / 3e-54 NAC ANAC019 NAC domain containing protein 19 (.1) AT3G04070 179 / 1e-53 NAC ANAC047 NAC domain containing protein 47 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008897 [exp] 433 / 4e-153 AT2G02450 315 / 5e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10008419 [exp] 339 / 2e-114 AT2G02450 327 / 7e-109 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10003367 [exp] 321 / 2e-106 AT2G02450 333 / 3e-110 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10008420 [exp] 307 / 1e-102 AT2G02450 320 / 2e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10030478 [exp] 194 / 4e-58 AT5G39820 297 / 4e-98 NAC domain containing protein 94 (.1) Lus10003269 [exp] 187 / 3e-56 AT3G04070 324 / 3e-109 NAC domain containing protein 47 (.1.2) Lus10015367 [exp] 186 / 3e-56 AT1G26870 298 / 8e-99 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10022636 [exp] 185 / 5e-56 AT2G17040 287 / 6e-97 NAC domain containing protein 36 (.1) Lus10037178 [exp] 189 / 6e-56 AT5G39820 306 / 3e-101 NAC domain containing protein 94 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G046700 [exp] 322 / 1e-108 AT2G02450 318 / 2e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Potri.004G230800 [exp] 315 / 8e-106 AT2G02450 311 / 2e-103 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Potri.019G031400 [exp] 186 / 7e-56 AT3G04070 332 / 1e-112 NAC domain containing protein 47 (.1.2) Potri.011G123300 [exp] 184 / 1e-55 AT4G27410 354 / 2e-122 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.001G404100 [exp] 184 / 1e-55 AT4G27410 370 / 8e-129 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.009G141600 [exp] 181 / 4e-55 AT2G17040 314 / 6e-108 NAC domain containing protein 36 (.1) Potri.017G082000 [exp] 183 / 2e-54 AT1G26870 299 / 3e-98 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.011G046700 [exp] 181 / 4e-54 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.002G081000 [exp] 179 / 4e-54 AT1G01720 416 / 5e-148 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.007G066300 [exp] 179 / 4e-54 AT3G12910 269 / 2e-89 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10023208 pacid=23180999 polypeptide=Lus10023208 locus=Lus10023208.g ID=Lus10023208.BGIv1.0 annot-version=v1.0 ATGAAGGAAAACAATGGCGATCGTGAAGTGGTCGACGAAGAAGAAGAAGATGAGCATGATCATGACATGGTGATGCCAGGGTTCAGGTTCCATCCCACAG AGGAAGAGCTTATCCAATTCTACCTCCGCCGTAAGGTTGAGGGCAAACCCTTCAACGTCGAACTCATCACTTTCCTCGACCTTTATCGCTACGACCCTTG GCACCTCCCTGCTATGGCGGCGATCGGGGAGAAAGAGTGGTTCTTCTATGTGCCTAGGGACAGGAAGTACAGGAACGGTGATAGGCCGAACCGGGTGACC ACTTCTGGTTACTGGAAGGCTACTGGGGCGGACCGGATGATTCGAGGTGAGAACTCGAGGTCTATCGGCCTGAAGAAAACCCTAGTGTTTTACTCAGGGA AGGCTCCCAAGGGGGTTCGGTCTAGCTGGATTATGAATGAGTATCGTCTTCCTCACCATGATACCCAACGATATCAGAAGACGGAGATATCGCTATGTCG AGTATACAAGAGACCAGGAGTCGAAGATCATCGCGGTGTACCATCGACATCGACTCTTCCGCGCTCTATTCCTTCGTCATTTAGGGCACGGCATCATCAG CAACATCCAGGTGCATCTTCTGCTGTGGGACTAATCTCCAACCAGCTCCCCACACTAACTCACCATCCACTACAGCTTCCTCCACAACAACAACAAGTAC TGGATCATGCTCAAGTAGAAGAAGATCAGCTCATGCTCCTAAACGGTACTAGTACTAACAACAATAATAATTTGGATGATTTGCATCGGCTAGTGAACTA CCAACAGAATCACGATCACCTTAGTTACCATCCACACCATCAGCTGCATATGTGGGAGTGGGACCGCTTTGGGGGGGGGGGGGCCCCCCCCCCGCCTCCG CGGCCACCTCAACATGATCATCAGAATCATGATCTTCAAGGTGGCCATAGATTGGCAGGTGATCATCATCACTACGAGACCAACAACCAAACTAATCTTT TCAAGTAA
AA sequence Show only first row Show all	>Lus10023208 pacid=23180999 polypeptide=Lus10023208 locus=Lus10023208.g ID=Lus10023208.BGIv1.0 annot-version=v1.0 MKENNGDREVVDEEEEDEHDHDMVMPGFRFHPTEEELIQFYLRRKVEGKPFNVELITFLDLYRYDPWHLPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVT TSGYWKATGADRMIRGENSRSIGLKKTLVFYSGKAPKGVRSSWIMNEYRLPHHDTQRYQKTEISLCRVYKRPGVEDHRGVPSTSTLPRSIPSSFRARHHQ QHPGASSAVGLISNQLPTLTHHPLQLPPQQQQVLDHAQVEEDQLMLLNGTSTNNNNNLDDLHRLVNYQQNHDHLSYHPHHQLHMWEWDRFGGGGAPPPPP RPPQHDHQNHDLQGGHRLAGDHHHYETNNQTNLFK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10023208 [exp]	0	1
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10008897 [exp]	1.0	0.9404
					Lus10001828 [exp]	1.4	0.9040
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10008419 [exp]	1.7	0.8786
					Lus10017461 [exp]	2.0	0.8439
AT1G07180		NDA1, ATNDI1	ARABIDOPSIS THALIANA INTERNAL ...		Lus10040657 [exp]	5.9	0.8375
AT3G51770		ATEOL1, ETO1	ARABIDOPSIS ETHYLENE OVERPRODU...		Lus10012510 [exp]	8.7	0.7496
AT3G24140	bHLH	bHLH097, FMA	FAMA, basic helix-loop-helix (...		Lus10016680 [exp]	9.5	0.8266
AT2G02950		PKS1	phytochrome kinase substrate 1...		Lus10036746 [exp]	12.0	0.8017
AT3G51760			Protein of unknown function (D...		Lus10022661 [exp]	12.8	0.7601
					Lus10025831 [exp]	13.0	0.8095

Compare expression of checked genes

Lus10023208 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.