Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30440 183 / 2e-57 GAE1 UDP-D-glucuronate 4-epimerase 1 (.1) AT1G02000 59 / 5e-11 GAE2 UDP-D-glucuronate 4-epimerase 2 (.1) AT4G00110 53 / 4e-09 GAE3 UDP-D-glucuronate 4-epimerase 3 (.1) AT4G12250 53 / 6e-09 GAE5 UDP-D-glucuronate 4-epimerase 5 (.1) AT3G23820 40 / 0.0002 GAE6 UDP-D-glucuronate 4-epimerase 6 (.1) AT2G45310 40 / 0.0002 GAE4 UDP-D-glucuronate 4-epimerase 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008893 [exp] 199 / 1e-63 AT4G30440 767 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1) Lus10015496 [exp] 187 / 9e-59 AT4G30440 764 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1) Lus10019967 [exp] 185 / 2e-58 AT4G30440 688 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1) Lus10000787 [exp] 59 / 4e-11 AT4G00110 731 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1) Lus10030281 [exp] 56 / 5e-10 AT4G00110 753 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1) Lus10015876 [exp] 56 / 8e-10 AT4G00110 751 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1) Lus10009288 [exp] 46 / 1e-06 AT4G00110 704 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1) Lus10023077 [exp] 42 / 3e-05 AT1G02000 244 / 2e-77 UDP-D-glucuronate 4-epimerase 2 (.1) Lus10022552 [exp] 39 / 0.0006 AT3G23820 742 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G100400 [exp] 182 / 4e-57 AT4G30440 771 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1) Potri.006G178500 [exp] 174 / 4e-54 AT4G30440 757 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1) Potri.014G068400 [exp] 70 / 5e-15 AT1G02000 714 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1) Potri.002G146500 [exp] 66 / 2e-13 AT1G02000 724 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1) Potri.001G320000 [exp] 44 / 7e-06 AT3G23820 714 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1) Potri.017G059100 [exp] 42 / 2e-05 AT3G23820 724 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1) Potri.003G114600 [exp] 39 / 0.0004 AT4G12250 587 / 0.0 UDP-D-glucuronate 4-epimerase 5 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023212 pacid=23181047 polypeptide=Lus10023212 locus=Lus10023212.g ID=Lus10023212.BGIv1.0 annot-version=v1.0 ATGCCGTCGCTGGAGGAGGAGCTGTTTCCGTCGACTCCGGGGAAGTTCAAGATCGACAGATCTCACCGCCAATTCTACCGATGCTTCTCCTCCACCAGCA CGATGTTCCTCTGGGCGCTCTTCTTGATCGCGTTGACTGCTTCCTACTTGAGCTTCCAGAGCTTCGTGGATTGTGGTAGCCGGTACCTCTCCGCCTCCTG GGGAGGGATCCAGTGGGAGAAACAGATCAGGAACTCCGCTCAGATCCACCGCGCCGGTGGAATCTCCGTCCTCGTCACCCGATCCGCCGGATTCCTCCGC CGCCCTTTCTCTGTCGCTTCCTCACTCGTTAGCTCTCAAAAAGCGCGGGGATGGAGTCGTCGGGATTGA
AA sequence Show only first row Show all	>Lus10023212 pacid=23181047 polypeptide=Lus10023212 locus=Lus10023212.g ID=Lus10023212.BGIv1.0 annot-version=v1.0 MPSLEEELFPSTPGKFKIDRSHRQFYRCFSSTSTMFLWALFLIALTASYLSFQSFVDCGSRYLSASWGGIQWEKQIRNSAQIHRAGGISVLVTRSAGFLR RPFSVASSLVSSQKARGWSRRD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30440		GAE1	UDP-D-glucuronate 4-epimerase ...		Lus10023212 [exp]	0	1
AT1G08750			Peptidase C13 family (.1.2.3)		Lus10006570 [exp]	2.0	0.8929
AT5G49170			unknown protein		Lus10006495 [exp]	4.5	0.8821
AT1G05810		ARA, Ara-1, AtR...	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10025876 [exp]	6.5	0.8941
AT3G16210			F-box family protein (.1)		Lus10023372 [exp]	6.9	0.8801
AT2G25270			unknown protein		Lus10038102 [exp]	10.2	0.8779
AT5G67540			Arabinanase/levansucrase/inver...		Lus10019280 [exp]	10.5	0.8920
AT5G05170		IXR1, CEV1, ATH...	ISOXABEN RESISTANT 1, CONSTIT...		Lus10039607 [exp]	12.4	0.8701
AT4G24060	DOF	AtDof4,6	Dof-type zinc finger DNA-bindi...		Lus10003208 [exp]	12.7	0.8581
AT4G17615		ATCBL1, SCABP5,...	SOS3-LIKE CALCIUM BINDING PROT...		Lus10000995 [exp]	13.1	0.8425
AT3G47520		pNAD-MDH, MDH	plastidic NAD-dependent malate...		Lus10000275 [exp]	13.2	0.8536

Compare expression of checked genes

Lus10023212 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.