Lus10023213 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G30440 199 / 6e-63 GAE1 UDP-D-glucuronate 4-epimerase 1 (.1)
AT2G45310 160 / 9e-48 GAE4 UDP-D-glucuronate 4-epimerase 4 (.1)
AT1G02000 160 / 1e-47 GAE2 UDP-D-glucuronate 4-epimerase 2 (.1)
AT4G00110 158 / 4e-47 GAE3 UDP-D-glucuronate 4-epimerase 3 (.1)
AT3G23820 154 / 2e-45 GAE6 UDP-D-glucuronate 4-epimerase 6 (.1)
AT4G12250 136 / 1e-38 GAE5 UDP-D-glucuronate 4-epimerase 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008893 223 / 7e-72 AT4G30440 767 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1)
Lus10015496 194 / 9e-61 AT4G30440 764 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1)
Lus10009288 160 / 1e-47 AT4G00110 704 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1)
Lus10015876 160 / 2e-47 AT4G00110 751 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1)
Lus10000787 158 / 5e-47 AT4G00110 731 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1)
Lus10030281 158 / 9e-47 AT4G00110 753 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1)
Lus10019967 155 / 4e-46 AT4G30440 688 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1)
Lus10016640 147 / 2e-42 AT3G23820 746 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1)
Lus10022552 146 / 4e-42 AT3G23820 742 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G100400 206 / 1e-65 AT4G30440 771 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1)
Potri.006G178500 202 / 4e-64 AT4G30440 757 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1)
Potri.014G068400 162 / 9e-49 AT1G02000 714 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1)
Potri.002G146500 161 / 4e-48 AT1G02000 724 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1)
Potri.001G320000 160 / 1e-47 AT3G23820 714 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1)
Potri.017G059100 158 / 1e-46 AT3G23820 724 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1)
Potri.012G128200 152 / 6e-45 AT1G02000 544 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1)
Potri.002G116750 131 / 1e-39 AT2G45310 209 / 6e-67 UDP-D-glucuronate 4-epimerase 4 (.1)
Potri.003G114600 129 / 4e-36 AT4G12250 587 / 0.0 UDP-D-glucuronate 4-epimerase 5 (.1)
PFAM info
Representative CDS sequence
>Lus10023213 pacid=23180920 polypeptide=Lus10023213 locus=Lus10023213.g ID=Lus10023213.BGIv1.0 annot-version=v1.0
ATGGCGTACTTCTCCTTCACGAGAAACATCCTCCAAGGGAAGCCGATCACGGTTTACCGGGGCAAGGACAGGGTCGATTTGGCCCGGGATTTCACCTACA
TTGACGATATAGTTAAAGGGTGTTTAGGTTCGCTGGATACTTCGGGGAAGAGTACCGGGTCGGGCGGGAAGAAAGCGGGTCCTGCACCGTATAGGATATT
CAACTTGGGGAATACTTCTCCGGTGACGGTGCCGAACTTGGTGGCGATACTGGAAAGGCATCTGAAGACGAAGGCGAAGAGGAAGGTGGTGGATATGCCT
GGAAACGGCGACGTACCGTACACCCACGCGAATATTAGCTTGGCGAGGAAGGAGCTCGGGAACAAACCGACGACGGATTTGCAGAGAGGAAGGTGGTGGA
TATGCCTGGAAACGGCGACGTACCGTACACCCACGCGAATATTAGCTTGGCGAGGAAGGAGCTCGGGTACAAACCGACGACGGATTTGCAGACCGGGTTG
A
AA sequence
>Lus10023213 pacid=23180920 polypeptide=Lus10023213 locus=Lus10023213.g ID=Lus10023213.BGIv1.0 annot-version=v1.0
MAYFSFTRNILQGKPITVYRGKDRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKAGPAPYRIFNLGNTSPVTVPNLVAILERHLKTKAKRKVVDMP
GNGDVPYTHANISLARKELGNKPTTDLQRGRWWICLETATYRTPTRILAWRGRSSGTNRRRICRPG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G30440 GAE1 UDP-D-glucuronate 4-epimerase ... Lus10023213 0 1
AT4G30440 GAE1 UDP-D-glucuronate 4-epimerase ... Lus10008893 1.4 0.9261
AT3G60520 unknown protein Lus10028179 2.4 0.8978
AT4G14450 ATBET12 unknown protein Lus10021208 3.2 0.8990
AT4G22240 Plastid-lipid associated prote... Lus10014790 3.7 0.8974
AT1G08250 AtADT6, ADT6 Arabidopsis thaliana arogenate... Lus10019526 4.6 0.9114
AT4G32020 unknown protein Lus10005344 5.1 0.9125
AT3G26330 CYP71B37 "cytochrome P450, family 71, s... Lus10016599 7.5 0.9048
AT2G43090 Aconitase/3-isopropylmalate de... Lus10007804 7.7 0.8908
AT4G30440 GAE1 UDP-D-glucuronate 4-epimerase ... Lus10015496 8.5 0.8945
AT3G25780 AOC3, AOC2 allene oxide cyclase 3 (.1) Lus10017571 9.0 0.8925

Lus10023213 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.