Lus10023215 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64620 45 / 5e-06 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
AT3G17230 42 / 0.0001 invertase/pectin methylesterase inhibitor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008892 252 / 2e-86 AT1G47960 48 / 6e-07 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017346 47 / 9e-07 AT3G17220 79 / 8e-19 pectin methylesterase inhibitor 2 (.1)
Lus10000822 39 / 0.0009 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G134900 44 / 2e-05 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.005G007100 42 / 3e-05 AT1G09360 85 / 6e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G127500 41 / 0.0001 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10023215 pacid=23180959 polypeptide=Lus10023215 locus=Lus10023215.g ID=Lus10023215.BGIv1.0 annot-version=v1.0
ATGGCTAGCTCTCTTTCAATCACTATTCTTATACTATCCCTAGCGATGATCAATCCTTCGTCAGGGTTCCGCTACACGCCCCAAGACGGAACGCTCGTAG
ACAAAATATGTCGAGATGCAAATGTCCAGAGGTTCTATGACTTTTGTGCAGAACTGTTCCACTCAGACCCCAGAGGTCCGACATCAGACCTCAAGGGTCT
GGTCAAGATCGCGTTGGAGAAGTCGGCATTGACAGTGATGCGCTCGCTAGTGTCCATGGACGACGCAGCCAGGTTAGGGGTGGGGAAAACAAACGACACT
GCCTATGCCAATCTCATGCAGTGCTCCGACCGGTATGGCCAGATCATCTACGACGTCTCTGAAGCGTTTAAATCGTCAAAAAATGGAGATTTTAATGCTG
TGGACAACAGTGCCCGAGCTATAATCGGGCAGACGAACGGATGCCTAAATGGGTTCGTGGGACCATGGGACGCTTCGGATTCTGCTAGAAAGTTGCATAA
CTTGGCCGTTATTGTAGCGGTCACTGCTAGTTTGTCTGGCTCGTAG
AA sequence
>Lus10023215 pacid=23180959 polypeptide=Lus10023215 locus=Lus10023215.g ID=Lus10023215.BGIv1.0 annot-version=v1.0
MASSLSITILILSLAMINPSSGFRYTPQDGTLVDKICRDANVQRFYDFCAELFHSDPRGPTSDLKGLVKIALEKSALTVMRSLVSMDDAARLGVGKTNDT
AYANLMQCSDRYGQIIYDVSEAFKSSKNGDFNAVDNSARAIIGQTNGCLNGFVGPWDASDSARKLHNLAVIVAVTASLSGS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10023215 0 1
AT3G16180 Major facilitator superfamily ... Lus10009506 1.4 1.0000
Lus10033149 2.0 1.0000
AT3G14040 Pectin lyase-like superfamily ... Lus10023364 3.0 1.0000
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10003281 3.9 1.0000
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10027028 4.9 1.0000
AT1G29430 SAUR-like auxin-responsive pro... Lus10020441 4.9 1.0000
AT1G75660 AtXRN3, XRN3 5'-3' exoribonuclease 3 (.1) Lus10005213 5.2 0.9900
AT4G30030 Eukaryotic aspartyl protease f... Lus10011612 5.3 0.9333
AT3G24140 bHLH bHLH097, FMA FAMA, basic helix-loop-helix (... Lus10007138 5.5 0.9823
AT1G21880 LYM1 lysm domain GPI-anchored prote... Lus10006200 6.0 1.0000

Lus10023215 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.