Lus10023219 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G34940 52 / 6e-08 ATGUS3 glucuronidase 3 (.1.2.3)
AT5G61250 40 / 0.0007 ATGUS1 glucuronidase 1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001922 100 / 2e-27 AT5G34940 82 / 3e-19 glucuronidase 3 (.1.2.3)
Lus10038109 44 / 2e-05 AT5G34940 678 / 0.0 glucuronidase 3 (.1.2.3)
Lus10008038 44 / 3e-05 AT5G34940 671 / 0.0 glucuronidase 3 (.1.2.3)
Lus10001952 44 / 4e-05 AT5G34940 149 / 9e-42 glucuronidase 3 (.1.2.3)
Lus10003468 40 / 0.0007 AT5G07830 691 / 0.0 glucuronidase 2 (.1)
Lus10015737 40 / 0.0008 AT5G07830 690 / 0.0 glucuronidase 2 (.1)
Lus10004664 40 / 0.0009 AT5G07830 519 / 0.0 glucuronidase 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G024200 62 / 1e-11 AT5G34940 664 / 0.0 glucuronidase 3 (.1.2.3)
Potri.006G062200 49 / 7e-07 AT5G34940 729 / 0.0 glucuronidase 3 (.1.2.3)
Potri.018G121500 45 / 9e-06 AT5G34940 734 / 0.0 glucuronidase 3 (.1.2.3)
Potri.015G049100 40 / 0.0005 AT5G07830 731 / 0.0 glucuronidase 2 (.1)
PFAM info
Representative CDS sequence
>Lus10023219 pacid=23180976 polypeptide=Lus10023219 locus=Lus10023219.g ID=Lus10023219.BGIv1.0 annot-version=v1.0
ATGGAGAGATCAGATTCCAAGGTCGATGCAATTTCAAGAGAACAATATTATTTAATTGTTAACGGTGGCGATCTACACAGTAGGACTGCACTTTTGAACG
GGAAAGCACAGGCGGTTGATACTTATATTGAAACTATACCTCAGTTGAAACCTGGTCGGATCAGACTGTCGGACCTAACAACTGTTACTTCGTTCTCTAT
AATGCTTATGCGTATTGCCGACATGACAGTTCCAGCCTATGGCCGCCGTCGTCGACCACTATTCCCACGGTCTCTGGACGACTATCGTAGCCATTATCAT
AACCATTTCGCTCCTACTCTCATCATCGCACGTGAAGTTTGTGCCAAATCACCGTGGGAGAGAGTATGCTGCGCTTACGAGAAGGCGAACACCGTGAAAA
TGTACTTCCTCAATGATCCCGTGGCGGGACACAAAAACTGCCGCCAATGTGCCGACATAATGGTCGAGGCGATCGACAAGATAATCCACGCCTCCGACAA
ATGGCAAGCCGAGGATTACGCGCAGCGCAGTCTTACGTTGAGTTGGAGGATGACATGA
AA sequence
>Lus10023219 pacid=23180976 polypeptide=Lus10023219 locus=Lus10023219.g ID=Lus10023219.BGIv1.0 annot-version=v1.0
MERSDSKVDAISREQYYLIVNGGDLHSRTALLNGKAQAVDTYIETIPQLKPGRIRLSDLTTVTSFSIMLMRIADMTVPAYGRRRRPLFPRSLDDYRSHYH
NHFAPTLIIAREVCAKSPWERVCCAYEKANTVKMYFLNDPVAGHKNCRQCADIMVEAIDKIIHASDKWQAEDYAQRSLTLSWRMT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G34940 ATGUS3 glucuronidase 3 (.1.2.3) Lus10023219 0 1

Lus10023219 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.