Lus10023221 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23730 367 / 3e-128 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G14130 365 / 7e-128 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT5G57560 322 / 8e-111 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT5G57550 321 / 2e-110 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G30270 316 / 1e-108 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT4G25810 316 / 2e-108 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT2G18800 305 / 9e-104 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
AT5G57530 303 / 3e-103 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT5G48070 298 / 2e-101 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
AT5G57540 297 / 6e-101 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008888 406 / 5e-145 AT4G14130 283 / 1e-96 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10028947 375 / 2e-131 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10008522 360 / 1e-125 AT3G23730 430 / 2e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10004723 357 / 3e-124 AT3G23730 431 / 1e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10021638 347 / 1e-120 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10000678 346 / 3e-120 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 327 / 2e-112 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 326 / 4e-112 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 323 / 3e-111 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G146100 374 / 5e-131 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 362 / 2e-126 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.005G201250 356 / 5e-124 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 356 / 5e-124 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060500 350 / 8e-122 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.011G077320 348 / 1e-120 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G060400 346 / 5e-120 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.018G095200 333 / 4e-115 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095100 333 / 6e-115 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.011G077380 331 / 4e-114 AT4G14130 345 / 2e-119 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10023221 pacid=23181016 polypeptide=Lus10023221 locus=Lus10023221.g ID=Lus10023221.BGIv1.0 annot-version=v1.0
ATGGGTTACCGGTTTTACAACTGGTTATTGTCATCACCCAATAACAATAGAAAGCATCAGCTTCGGACATTATTAGTTATGGTGATGATGCTGATGTCGA
TGCAGAAAACAGCCGAAGGGGGGAATTTCAACGAGGACGTGGACCTGACGTGGGGTGGGGAGCGAGCACAAATCAAGGACGGAGGGAACCTGATCTCACT
GTCCCTCGATCGGGACTCTGGATCAGGTTTCCAGTCCAAATCTGATTACATGTTCGCCAGGATTGATTTGCAGCTTAAACTAGTCCCCCGTGACGCTGCT
GGCACCGTCACCGCCTATTACTTGTCATCACAAGGACCAATCCACGACGAAATCGACTTCGAATTTCTCGGAAACGTCAGCGGTCAGCCTTACACACTAC
ACACCAACGTGTACACACACGGCCACGGCAACCGAGAGCAACAGTTCTTCCTCTGGTTTGATCCCACTAGAAACTTCCACACTTACTCCATCATCTGGAA
GCCCCAACACATCATATTCTTGGTGGACCACATCCCGATAAGGGTGTTCAAGAATTTGCGGAAGTACGGGGTGCCATTCCCGAGGAAGCAGCCGATGAAG
CTCTACTGCAGCATCTGGGATGCCGATGACTGGGCGACACGTGGTGGGTTGGTCAAGACCGACTGGTCAATGGCTCCCTTCACTTCCTACTTCCGTAACT
TCCAAGCAACTCCGTACACCAACTTCGCCCACAACGGTCGGGGAAAGTTCAGGGAGGCTGGGGACCCGGATATCGATGCGTACGCGAGGAAGAGGCTCCG
GTGGGTCGAGAAGTACTTCATGATCTATAACTACTGTACCGATGTCAACCGGTTCCAGGGCCGTCTCCCGCCTGAATGCAAACACTCTAGCGCACTATGA
AA sequence
>Lus10023221 pacid=23181016 polypeptide=Lus10023221 locus=Lus10023221.g ID=Lus10023221.BGIv1.0 annot-version=v1.0
MGYRFYNWLLSSPNNNRKHQLRTLLVMVMMLMSMQKTAEGGNFNEDVDLTWGGERAQIKDGGNLISLSLDRDSGSGFQSKSDYMFARIDLQLKLVPRDAA
GTVTAYYLSSQGPIHDEIDFEFLGNVSGQPYTLHTNVYTHGHGNREQQFFLWFDPTRNFHTYSIIWKPQHIIFLVDHIPIRVFKNLRKYGVPFPRKQPMK
LYCSIWDADDWATRGGLVKTDWSMAPFTSYFRNFQATPYTNFAHNGRGKFREAGDPDIDAYARKRLRWVEKYFMIYNYCTDVNRFQGRLPPECKHSSAL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10023221 0 1
AT5G35750 AHK2 histidine kinase 2 (.1) Lus10009736 3.5 1.0000
AT1G07985 Expressed protein (.1) Lus10029516 3.5 1.0000
AT5G13620 unknown protein Lus10017168 5.5 1.0000
AT2G45200 ATGOS12, GOS12 golgi snare 12 (.1.2) Lus10015880 5.7 1.0000
Lus10005378 10.2 1.0000
AT1G66370 MYB ATMYB113 myb domain protein 113 (.1) Lus10003277 11.0 1.0000
AT2G13450 unknown protein Lus10005336 11.2 1.0000
AT3G49210 O-acyltransferase (WSD1-like) ... Lus10022417 11.7 1.0000
Lus10015929 11.8 1.0000
AT1G17260 AHA10 autoinhibited H\(+\)-ATPase is... Lus10003924 12.0 1.0000

Lus10023221 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.