Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14010 57 / 3e-11 RALFL32 ralf-like 32 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008885 [exp] 138 / 5e-43 AT4G14010 82 / 2e-21 ralf-like 32 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G321300 [exp] 74 / 5e-18 AT4G14010 60 / 1e-12 ralf-like 32 (.1) Potri.017G059800 [exp] 71 / 9e-17 AT4G14010 70 / 1e-16 ralf-like 32 (.1) Potri.001G321500 [exp] 56 / 5e-11 AT4G14010 54 / 3e-10 ralf-like 32 (.1) Potri.017G059900 [exp] 55 / 1e-10 AT4G14010 45 / 4e-07 ralf-like 32 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [flax] [poplar] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Lus10023223 pacid=23180989 polypeptide=Lus10023223 locus=Lus10023223.g ID=Lus10023223.BGIv1.0 annot-version=v1.0 ATGGAGAAACCCTCTTTCCTCCTATTCATCTTCTTCCTCCATGTACTAGCTTCAGCGGCAGCAAGTACTTGTTCATCTCCAACATTAGCCACACCATCAA TCTGTACTAGTACAGCTGGTAACAGTACTACTAGTACTAGTACAAGTACTATTTCCATGCTGATGATGTCGGCCGAAAACTACATTGGGGGGAAGAGGAG ATATGTACAGGAGGCCAGAGCTGCGTCGACGAACAAGTACATAACGCCGGGAGCTTTGAAGAAAGATCAACCGGTGTGTAACGGAGGAAGCAGCGGACAG TCTTACAGTAGCAGCTGCTTGCCCCCTCCTTCAAATCCTCATACCCGTGGCTGCTCCAGATACTATCGCTGTCGTTCTGATTCTTGA
AA sequence Show only first row Show all	>Lus10023223 pacid=23180989 polypeptide=Lus10023223 locus=Lus10023223.g ID=Lus10023223.BGIv1.0 annot-version=v1.0 MEKPSFLLFIFFLHVLASAAASTCSSPTLATPSICTSTAGNSTTSTSTSTISMLMMSAENYIGGKRRYVQEARAASTNKYITPGALKKDQPVCNGGSSGQ SYSSSCLPPPSNPHTRGCSRYYRCRSDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14010		RALFL32	ralf-like 32 (.1)		Lus10023223 [exp]	0	1
AT5G24580			Heavy metal transport/detoxifi...		Lus10015583 [exp]	3.0	0.8324
AT4G11150		TUFF, EMB2448, ...	embryo defective 2448, vacuola...		Lus10032349 [exp]	3.0	0.8777
AT3G25580			Thioredoxin superfamily protei...		Lus10013889 [exp]	4.7	0.8504
AT1G65980		TPX1	thioredoxin-dependent peroxida...		Lus10015077 [exp]	7.1	0.8263
AT3G07190			B-cell receptor-associated pro...		Lus10038188 [exp]	8.4	0.8238
AT1G07090		LSH6	LIGHT SENSITIVE HYPOCOTYLS 6, ...		Lus10038424 [exp]	10.8	0.8314
AT5G17190			unknown protein		Lus10034347 [exp]	11.7	0.7783
AT1G58210		EMB1674	EMBRYO DEFECTIVE 1674, kinase ...		Lus10001866 [exp]	15.1	0.8251
AT3G15730		PLDALPHA1	phospholipase D alpha 1 (.1)		Lus10031634 [exp]	16.2	0.8038
AT2G45960		PIP1;2, ATHH2, ...	TRANSMEMBRANE PROTEIN A, NAMED...		Lus10035483 [exp]	17.0	0.7916

Compare expression of checked genes

Lus10023223 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.