Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G32928 38 / 8e-05 unknown protein AT5G54165 37 / 0.0003 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001526 [exp] 79 / 8e-21 AT1G32920 50 / 1e-09 unknown protein Lus10033221 [exp] 76 / 1e-19 AT1G32928 49 / 5e-09 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G151600 [exp] 51 / 7e-10 AT1G32928 57 / 2e-12 unknown protein Potri.015G004800 [exp] 50 / 1e-09 AT5G54165 47 / 2e-08 unknown protein Potri.001G449900 [exp] 48 / 2e-08 AT1G32928 64 / 7e-15 unknown protein Potri.001G449800 [exp] 48 / 2e-08 AT1G32928 64 / 7e-15 unknown protein Potri.001G450000 [exp] 47 / 2e-08 AT1G32928 64 / 6e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023231 pacid=23181052 polypeptide=Lus10023231 locus=Lus10023231.g ID=Lus10023231.BGIv1.0 annot-version=v1.0 ATGATGATGTCGATGTTCAGCTCGTTCGATATTCTGTCGGGGGAGTTCTTCGGGCAAAAGACCAATAACATGCCCTCCATCCTTTCCAATAAGAAATCAC AGCCGGAGGCGGCGAAATCGGACGCCGGTAAGTCGCCGTCGTCACCGTCACAGCCGCAGAAGCAGCAAGGAGCTGAATCGGACGAGATGAGGAGACGCCG GCGGGCGATGGTGACGAGATTTGGAGTGGAATTTGATGGGCTTAACTGTTTCGAGACGATTCTGCCTTGCTGA
AA sequence Show only first row Show all	>Lus10023231 pacid=23181052 polypeptide=Lus10023231 locus=Lus10023231.g ID=Lus10023231.BGIv1.0 annot-version=v1.0 MMMSMFSSFDILSGEFFGQKTNNMPSILSNKKSQPEAAKSDAGKSPSSPSQPQKQQGAESDEMRRRRRAMVTRFGVEFDGLNCFETILPC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G54165			unknown protein		Lus10023231 [exp]	0	1
AT5G48150	GRAS	PAT1	phytochrome a signal transduct...		Lus10036623 [exp]	1.4	0.9381
AT1G80840	WRKY	ATWRKY40, WRKY4...	WRKY DNA-binding protein 40 (....		Lus10024074 [exp]	1.4	0.9655
AT1G18970		GLP4	germin-like protein 4 (.1)		Lus10043393 [exp]	2.4	0.9260
AT1G32928			unknown protein		Lus10033221 [exp]	3.0	0.9021
AT1G18210			Calcium-binding EF-hand family...		Lus10018012 [exp]	4.0	0.9240
AT2G45760		BAL, BAP2	BON ASSOCIATION PROTEIN 1-LIKE...		Lus10040924 [exp]	4.7	0.8949
AT1G29690		CAD1	constitutively activated cell ...		Lus10002768 [exp]	4.9	0.8885
AT1G75860			unknown protein		Lus10033130 [exp]	5.5	0.9154
AT5G17680			disease resistance protein (TI...		Lus10041060 [exp]	6.5	0.8846
AT1G80840	WRKY	ATWRKY40, WRKY4...	WRKY DNA-binding protein 40 (....		Lus10041660 [exp]	8.4	0.9180

Compare expression of checked genes

Lus10023231 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.