Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52590 86 / 5e-23 HAP4, ERD16, UBQ1, EMB2167 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) AT2G36170 86 / 5e-23 Ubiquitin supergroup;Ribosomal protein L40e (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022695 [exp] 87 / 4e-24 AT2G36170 120 / 3e-37 Ubiquitin supergroup;Ribosomal protein L40e (.1) Lus10008873 [exp] 87 / 9e-24 AT3G52590 261 / 5e-92 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Lus10014220 [exp] 39 / 0.0001 AT3G11510 236 / 4e-78 Ribosomal protein S11 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G077200 [exp] 86 / 4e-23 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.012G024300 [exp] 86 / 4e-23 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.015G007100 [exp] 86 / 4e-23 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.004G194000 [exp] 60 / 6e-13 AT3G52590 210 / 3e-71 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.016G077000 [exp] 36 / 0.0004 AT3G52590 194 / 1e-65 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF01020 [flax] [poplar] Ribosomal_L40e Ribosomal L40e family
Representative CDS sequence Show only first row Show all	>Lus10023236 pacid=23180933 polypeptide=Lus10023236 locus=Lus10023236.g ID=Lus10023236.BGIv1.0 annot-version=v1.0 ATGGCTTTAGCCAGGAAGTACAACCAAGATAAGATGATATGCCGCAAGTGTTACGCACGCCTCCACCCCCGAGCTGTCAACTGCAGGAAGAAGAAATGTG GACACAGCAACCAGGTGACGCGCCACTCAATCGTGATAATGGTTGTTTGTATCCTGTCATTGGGACGTAAAGTTGTTACTCCGATTTCCAGAGCGTTGGA GTTTATCAAGTTCTCCCGATTGGCTACACCGAACTATCTGTCGATTTCCTTGGAATGA
AA sequence Show only first row Show all	>Lus10023236 pacid=23180933 polypeptide=Lus10023236 locus=Lus10023236.g ID=Lus10023236.BGIv1.0 annot-version=v1.0 MALARKYNQDKMICRKCYARLHPRAVNCRKKKCGHSNQVTRHSIVIMVVCILSLGRKVVTPISRALEFIKFSRLATPNYLSISLE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G52590		HAP4, ERD16, UB...	HAPLESS 4, EARLY-RESPONSIVE TO...		Lus10023236 [exp]	0	1
AT3G07170			Sterile alpha motif (SAM) doma...		Lus10022780 [exp]	10.8	0.8106
AT3G12530		PSF2	PSF2 (.1.2)		Lus10002696 [exp]	29.8	0.8049
AT3G48710			DEK domain-containing chromati...		Lus10025759 [exp]	37.9	0.8023
AT1G15660		CENP-C	CENP-C HOMOLOGUE, centromere p...		Lus10011470 [exp]	39.8	0.7937
AT3G50620			P-loop containing nucleoside t...		Lus10009348 [exp]	76.0	0.7700
AT1G51510		Y14	RNA-binding (RRM/RBD/RNP motif...		Lus10009963 [exp]	79.7	0.7635
AT4G02560	HD	LD	luminidependens, Homeodomain-l...		Lus10040921 [exp]	81.0	0.7396
AT5G57120			unknown protein		Lus10001627 [exp]	107.1	0.7588
AT5G22220	E2F_DP	ATE2FB, E2F1	E2F transcription factor 1 (.2...		Lus10005209 [exp]	111.0	0.7237
AT1G58470		XF41, ATRBP1	RNA-binding protein 1 (.1)		Lus10007721 [exp]	112.9	0.7579

Compare expression of checked genes

Lus10023236 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.