Lus10023243 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G27700 268 / 3e-91 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT5G66040 49 / 1e-07 STR16 sulfurtransferase protein 16 (.1.2)
AT3G08920 49 / 8e-07 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT2G21045 47 / 1e-06 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT5G66170 46 / 3e-06 STR18 sulfurtransferase 18 (.1.2.3)
AT2G17850 45 / 6e-06 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT4G35770 45 / 7e-06 ATSEN1, DIN1, SEN1 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
AT2G42220 46 / 8e-06 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT4G24750 42 / 0.0001 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008866 344 / 2e-121 AT4G27700 249 / 4e-84 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10012566 58 / 2e-10 AT5G66040 129 / 1e-39 sulfurtransferase protein 16 (.1.2)
Lus10041525 59 / 7e-10 AT5G14030 216 / 8e-70 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Lus10028390 54 / 9e-09 AT4G35770 182 / 3e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Lus10005635 54 / 1e-08 AT5G66040 144 / 1e-44 sulfurtransferase protein 16 (.1.2)
Lus10004811 54 / 1e-08 AT3G08920 239 / 3e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10041894 53 / 1e-08 AT5G66170 120 / 1e-35 sulfurtransferase 18 (.1.2.3)
Lus10002485 53 / 2e-08 AT3G08920 239 / 3e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10041843 50 / 2e-07 AT4G35770 182 / 6e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G020700 301 / 2e-104 AT4G27700 262 / 4e-89 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.015G008000 301 / 4e-104 AT4G27700 268 / 2e-91 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.006G100600 62 / 1e-11 AT3G08920 238 / 6e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.014G131300 52 / 1e-08 AT2G21045 204 / 2e-68 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.002G014900 52 / 2e-08 AT4G35770 151 / 8e-47 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Potri.005G106400 53 / 3e-08 AT4G35770 199 / 1e-64 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Potri.015G086100 44 / 4e-05 AT4G24750 416 / 1e-147 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0031 Phosphatase PF00581 Rhodanese Rhodanese-like domain
Representative CDS sequence
>Lus10023243 pacid=23181072 polypeptide=Lus10023243 locus=Lus10023243.g ID=Lus10023243.BGIv1.0 annot-version=v1.0
ATGGCGGCTGCCGTACTTCCTTCAATCCCCTCTCCATCTTCTTCTTCTTCTTCTTCTTCAACTAGTTTTTCTCATTCCAAGCCATCTGCTCCATCATCCT
TCTTCACCGTCAGACCGTACGGCAGAATCAAAGGAAACCTCTCAAACTCTCGCCACTCTGTTCCAAAGATCCTATGTGCAGCAACAAAGACTGCAAAGTC
TCCAGCTGAAGAAGAATGGAAGGTCAAGAGAGAATTGCTTTTGCAGAAAAAAGTCAGGAGTGTAGAAGTTAAGGAAGCTCTTCGCCTTCAGAAGGAGAAC
AACTTTGTCATCCTTGATGTCAGACCTGAAGCTGAGTTCAAAGAGGCTCATCCACCGGATGCAATCAATGTCCAAATATACAGACTTATAAAGGAGTGGA
CGGCCTGGGACATAGCCAGGCGTGCTGCATTCGCATTTTTCGGCATCTTTGCTGGCACCGAAGAGAACCCTGAGTTTATACAGACTATGGAATCCAAACT
TAGTAAAGATTCGAAGATTATCGTGGCTTGCTCAGCAGGAGGCACGATGAAACCGTCGCAAAATCTTCCTGAAGGTCAGCAATCCAGATCATTGATAGCA
GCGTACCTGTTAGTCCTCAATGGTTATAAGAACGTCTTCCATTTAGAAGGCGGTCTGTATACGTGGTTCAAGGAGGGGTTGCCGGCGGTTGGTGAAGAAG
AGTGA
AA sequence
>Lus10023243 pacid=23181072 polypeptide=Lus10023243 locus=Lus10023243.g ID=Lus10023243.BGIv1.0 annot-version=v1.0
MAAAVLPSIPSPSSSSSSSSTSFSHSKPSAPSSFFTVRPYGRIKGNLSNSRHSVPKILCAATKTAKSPAEEEWKVKRELLLQKKVRSVEVKEALRLQKEN
NFVILDVRPEAEFKEAHPPDAINVQIYRLIKEWTAWDIARRAAFAFFGIFAGTEENPEFIQTMESKLSKDSKIIVACSAGGTMKPSQNLPEGQQSRSLIA
AYLLVLNGYKNVFHLEGGLYTWFKEGLPAVGEEE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G27700 Rhodanese/Cell cycle control p... Lus10023243 0 1
AT5G45930 CHLI-2, CHLI2 magnesium chelatase i2 (.1) Lus10015302 1.0 0.9595
AT4G27700 Rhodanese/Cell cycle control p... Lus10008866 1.4 0.9581
AT1G64355 unknown protein Lus10003895 3.2 0.9430
AT1G23360 MENG S-adenosyl-L-methionine-depend... Lus10033614 3.9 0.9491
AT3G46780 PTAC16 plastid transcriptionally acti... Lus10040768 4.6 0.9539
AT2G30570 PSBW photosystem II reaction center... Lus10033862 7.9 0.9478
AT1G55670 PSAG photosystem I subunit G (.1) Lus10017476 9.2 0.9480
AT4G05180 PSII-Q, PSBQ, P... photosystem II subunit Q-2 (.1... Lus10007627 10.4 0.9507
AT1G73060 LPA3 Low PSII Accumulation 3 (.1) Lus10002315 10.7 0.9378
AT3G59780 Rhodanese/Cell cycle control p... Lus10027050 10.7 0.9346

Lus10023243 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.