Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27740 124 / 2e-38 Yippee family putative zinc-binding protein (.1) AT4G27745 119 / 3e-36 Yippee family putative zinc-binding protein (.1) AT3G08990 105 / 2e-30 Yippee family putative zinc-binding protein (.1.2) AT3G55890 99 / 3e-28 Yippee family putative zinc-binding protein (.1) AT2G40110 98 / 5e-28 Yippee family putative zinc-binding protein (.1.2) AT3G11230 94 / 3e-26 Yippee family putative zinc-binding protein (.1.2) AT5G53940 94 / 4e-26 Yippee family putative zinc-binding protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000335 [exp] 117 / 1e-35 AT4G27745 195 / 2e-66 Yippee family putative zinc-binding protein (.1) Lus10033226 [exp] 117 / 2e-35 AT4G27745 194 / 6e-66 Yippee family putative zinc-binding protein (.1) Lus10007773 [exp] 115 / 1e-34 AT4G27745 186 / 7e-63 Yippee family putative zinc-binding protein (.1) Lus10028300 [exp] 107 / 4e-31 AT2G40110 228 / 8e-79 Yippee family putative zinc-binding protein (.1.2) Lus10040190 [exp] 105 / 2e-30 AT2G40110 228 / 1e-78 Yippee family putative zinc-binding protein (.1.2) Lus10013992 [exp] 100 / 1e-28 AT5G53940 157 / 1e-50 Yippee family putative zinc-binding protein (.1) Lus10035531 [exp] 100 / 1e-28 AT3G08990 174 / 2e-57 Yippee family putative zinc-binding protein (.1.2) Lus10027762 [exp] 100 / 3e-28 AT2G40110 173 / 4e-57 Yippee family putative zinc-binding protein (.1.2) Lus10015416 [exp] 99 / 4e-28 AT5G53940 169 / 1e-55 Yippee family putative zinc-binding protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G019200 [exp] 152 / 3e-49 AT4G27740 131 / 4e-41 Yippee family putative zinc-binding protein (.1) Potri.015G009100 [exp] 147 / 2e-47 AT4G27740 131 / 4e-41 Yippee family putative zinc-binding protein (.1) Potri.001G085400 [exp] 121 / 3e-37 AT4G27745 197 / 3e-67 Yippee family putative zinc-binding protein (.1) Potri.015G009200 [exp] 115 / 5e-35 AT4G27745 201 / 1e-68 Yippee family putative zinc-binding protein (.1) Potri.012G019100 [exp] 115 / 5e-35 AT4G27745 202 / 2e-69 Yippee family putative zinc-binding protein (.1) Potri.014G101600 [exp] 109 / 1e-32 AT4G27745 154 / 2e-50 Yippee family putative zinc-binding protein (.1) Potri.003G145400 [exp] 108 / 7e-32 AT4G27745 179 / 3e-60 Yippee family putative zinc-binding protein (.1) Potri.010G190000 [exp] 103 / 1e-29 AT2G40110 224 / 6e-77 Yippee family putative zinc-binding protein (.1.2) Potri.008G067100 [exp] 103 / 2e-29 AT2G40110 232 / 1e-79 Yippee family putative zinc-binding protein (.1.2) Potri.016G115000 [exp] 98 / 3e-27 AT3G11230 154 / 2e-49 Yippee family putative zinc-binding protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0080 [flax] [poplar] Beta-tent PF03226 [flax] [poplar] Yippee-Mis18 Yippee zinc-binding/DNA-binding /Mis18, centromere assembly
Representative CDS sequence Show only first row Show all	>Lus10023244 pacid=23181014 polypeptide=Lus10023244 locus=Lus10023244.g ID=Lus10023244.BGIv1.0 annot-version=v1.0 ATGGTGGAATCTGGTGGGCATCCGTTGTACAGCTGCAACAACTGCAGGACCCCTCTTGCCTTCCATGCTGATCTCCTTTCCAAGAAGTTCAAGGCGAAAA CAGGGCAGGCGTACATGTTCTCGCATGTGATGAACGTGGTGCTGGGGGAGAAGGTAGAGAAGCAGTTGATGACTGGTGCTTTCAAAATCGCCGATATTCG ATGCAGCGGCTGCGGTCAGGGTCTGGGCTGGAAGTACGTTGTGGCGTATGATGCCAAGCAGAAGTACAAGGAAGGCAACTTCATACTCGAGCTTTCCAAG CTTCTCAAGCAATATTAA
AA sequence Show only first row Show all	>Lus10023244 pacid=23181014 polypeptide=Lus10023244 locus=Lus10023244.g ID=Lus10023244.BGIv1.0 annot-version=v1.0 MVESGGHPLYSCNNCRTPLAFHADLLSKKFKAKTGQAYMFSHVMNVVLGEKVEKQLMTGAFKIADIRCSGCGQGLGWKYVVAYDAKQKYKEGNFILELSK LLKQY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27740			Yippee family putative zinc-bi...		Lus10023244 [exp]	0	1
AT1G44542			Cyclase family protein (.1)		Lus10014091 [exp]	1.7	0.9258
AT4G18880	HSF	AT-HSFA4A ,HSF ...	ARABIDOPSIS THALIANA HEAT SHOC...		Lus10007318 [exp]	3.9	0.9384
AT5G36930			Disease resistance protein (TI...		Lus10007828 [exp]	5.5	0.9184
AT4G18880	HSF	AT-HSFA4A ,HSF ...	ARABIDOPSIS THALIANA HEAT SHOC...		Lus10029268 [exp]	6.5	0.9280
AT2G37570		SLT1	sodium- and lithium-tolerant 1...		Lus10025337 [exp]	7.3	0.8900
AT3G19460			Reticulon family protein (.1.2...		Lus10014102 [exp]	8.8	0.9039
AT5G06340		ATNUDX27	nudix hydrolase homolog 27 (.1...		Lus10016955 [exp]	11.2	0.9041
AT3G49200			O-acyltransferase (WSD1-like) ...		Lus10019840 [exp]	12.7	0.8971
AT2G23520			Pyridoxal phosphate (PLP)-depe...		Lus10016752 [exp]	13.4	0.8977
AT4G27120			unknown protein		Lus10011161 [exp]	14.1	0.9148

Compare expression of checked genes

Lus10023244 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.