Lus10023259 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G36810 173 / 9e-54 GGPS1 geranylgeranyl pyrophosphate synthase 1 (.1)
AT2G18620 167 / 9e-52 Terpenoid synthases superfamily protein (.1)
AT2G23800 149 / 2e-44 GGPS5, GGPS2 GERANYLGERANYL PYROPHOSPHATE SYNTHASE 5, geranylgeranyl pyrophosphate synthase 2 (.1)
AT2G18640 147 / 1e-43 GGPS4 geranylgeranyl pyrophosphate synthase 4 (.1)
AT3G14530 137 / 7e-40 Terpenoid synthases superfamily protein (.1)
AT1G49530 135 / 2e-39 GGPS6 geranylgeranyl pyrophosphate synthase 6 (.1)
AT3G14510 134 / 3e-39 Polyprenyl synthetase family protein (.1)
AT3G14550 135 / 6e-39 GGPS3 geranylgeranyl pyrophosphate synthase 3 (.1)
AT3G29430 134 / 7e-39 Terpenoid synthases superfamily protein (.1)
AT3G32040 130 / 3e-37 Terpenoid synthases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028509 208 / 3e-67 AT4G36810 437 / 2e-153 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10028508 179 / 4e-56 AT4G36810 380 / 9e-132 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10028507 172 / 4e-53 AT4G36810 375 / 2e-129 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10017624 173 / 9e-53 AT4G36810 439 / 5e-153 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10017625 167 / 2e-51 AT4G36810 423 / 5e-148 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10009138 167 / 3e-51 AT4G36810 373 / 2e-128 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10022499 164 / 5e-50 AT4G36810 491 / 8e-175 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10016803 156 / 6e-47 AT4G36810 488 / 2e-173 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10033582 111 / 5e-31 AT4G36810 305 / 6e-104 geranylgeranyl pyrophosphate synthase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G090600 171 / 1e-52 AT4G36810 419 / 1e-146 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.005G127100 166 / 8e-51 AT4G36810 444 / 2e-156 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.007G031100 166 / 1e-50 AT4G36810 467 / 1e-165 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.017G124700 157 / 1e-47 AT4G36810 413 / 1e-144 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.017G124600 151 / 3e-45 AT4G36810 388 / 2e-134 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.009G139600 129 / 5e-37 AT4G38460 389 / 7e-136 geranylgeranyl reductase (.1)
Potri.004G179628 129 / 7e-37 AT4G38460 403 / 3e-141 geranylgeranyl reductase (.1)
Potri.001G380500 62 / 5e-12 AT1G78510 597 / 0.0 solanesyl diphosphate synthase 1 (.1.2)
Potri.015G043400 51 / 5e-08 AT4G38460 121 / 4e-32 geranylgeranyl reductase (.1)
Potri.011G099500 49 / 2e-07 AT1G78510 415 / 8e-144 solanesyl diphosphate synthase 1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0613 Terp_synthase PF00348 polyprenyl_synt Polyprenyl synthetase
Representative CDS sequence
>Lus10023259 pacid=23181090 polypeptide=Lus10023259 locus=Lus10023259.g ID=Lus10023259.BGIv1.0 annot-version=v1.0
ATGCGGTACTCCCTCCTCGCCGGCGGCAAGCGCGTCCGTCCCGTCCTCTGCATCGCCGCCTGCGAGATGGTTGGAGGCGACGACTCGATCGCAATGCCGA
TGGCCTGCGCCACAGAGATGATTCACACCATGTCTCTCATCCACGATGACCTCCCCTGCATGGACAACGACGACCTCCGCCGTGGAGTCCCTACTAATCA
CAAGAAGTACGGCGAGGACACCGCTATTCTCGCCGGCGAAGCTCTCCTCTCCTTCTCCTTCGAGCACGTCGCCGCCCAGACCCCTAAAACTGTCTCCCGG
AGCGAATCGTTTGGTCGATCGCCGAGCTCGGATCCGCGGGAAGAGGGAGGAATAATTTTTTTTGTAATTTTAAATTTGTTAAGTAATGATGGCCATTTTG
TCGATGTGGCGTGCATTAGTGGTAAAATTACGTGGCGAAAAGGATGGAAATGA
AA sequence
>Lus10023259 pacid=23181090 polypeptide=Lus10023259 locus=Lus10023259.g ID=Lus10023259.BGIv1.0 annot-version=v1.0
MRYSLLAGGKRVRPVLCIAACEMVGGDDSIAMPMACATEMIHTMSLIHDDLPCMDNDDLRRGVPTNHKKYGEDTAILAGEALLSFSFEHVAAQTPKTVSR
SESFGRSPSSDPREEGGIIFFVILNLLSNDGHFVDVACISGKITWRKGWK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10023259 0 1
AT2G18620 Terpenoid synthases superfamil... Lus10009136 1.0 0.9944
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10009137 2.4 0.9851
AT1G63970 MECPS, ISPF 2C-METHYL-D-ERYTHRITOL 2,4-CYC... Lus10028759 4.9 0.9852
AT1G10370 GST30B, ATGSTU1... GLUTATHIONE S-TRANSFERASE U17,... Lus10030805 4.9 0.9784
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10013593 5.7 0.9831
AT1G05680 UGT74E2 Uridine diphosphate glycosyltr... Lus10024486 8.3 0.9639
AT3G62150 ABCB21, PGP21 ATP-binding cassette B21, P-gl... Lus10038049 8.5 0.9708
AT1G15170 MATE efflux family protein (.1... Lus10018134 9.5 0.9721
AT3G53180 NodGS nodulin/glutamine synthase-lik... Lus10023900 9.8 0.9714
AT1G16120 WAKL1 wall associated kinase-like 1 ... Lus10008105 10.5 0.9797

Lus10023259 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.