Lus10023263 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23880 48 / 1e-06 F-box and associated interaction domains-containing protein (.1)
AT4G12560 47 / 2e-06 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
AT4G22390 47 / 2e-06 F-box associated ubiquitination effector family protein (.1)
AT3G16210 40 / 0.0005 F-box family protein (.1)
AT1G32600 40 / 0.0007 F-box associated ubiquitination effector family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038541 91 / 2e-23 AT3G52320 45 / 2e-06 F-box and associated interaction domains-containing protein (.1)
Lus10014136 87 / 1e-21 AT3G06240 45 / 2e-10 F-box family protein (.1)
Lus10011015 85 / 2e-19 AT3G06240 94 / 7e-21 F-box family protein (.1)
Lus10006687 84 / 2e-19 AT4G12560 81 / 5e-17 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Lus10006697 75 / 9e-16 AT4G12560 80 / 4e-16 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Lus10007040 67 / 6e-13 AT3G06240 86 / 4e-18 F-box family protein (.1)
Lus10023238 45 / 1e-05 AT3G23880 126 / 6e-33 F-box and associated interaction domains-containing protein (.1)
Lus10008871 45 / 2e-05 AT4G12560 135 / 1e-35 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Lus10023239 43 / 8e-05 AT3G23880 130 / 3e-34 F-box and associated interaction domains-containing protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10023263 pacid=23180917 polypeptide=Lus10023263 locus=Lus10023263.g ID=Lus10023263.BGIv1.0 annot-version=v1.0
ATGGCCGGACAGAAAGGAAAGAAGAAGGCCGGCTTCTACAGTCGAAAACGGCTTCCGATTGTCTTCCTTACCGGAGGACATAGTCTTGCACATCTTGGTC
AGACTTCCGGCGAAGACTCTGGTACGATTCAAGTGCTTATCCAAACGCATTCACCATCTCATTCAATCCCCATATTGCGTGGCTGCACACGCCGACCATC
AAGTCGCGAATCGTGCCGGACTCTCCCTCCTCACTTACCGGCTCGGGGAGCCGGAAAGAAGGGATTTCCGTGCCTGCTTTTGCGGAATCCAGAAAATATG
TCTCTCTGGAATCCAACCACCTACCAGTTCTGCTTTGCTTCTCTCCCGTCGTCGTATGCTAAATGTTATGCGATGTACGGATTTGGGTACAATTCTGTGT
CGGATGATTTCAAGTCAATAAGGATTGTCTTGCGGAAGAATCATCGTGGTCCCGCCCCAGCGGAGGTTCTGAGTTGGAGGAAGAGGACTTGGACGAAGCT
CACAGCCGAATCACGGAGCTTCTTAGACCTACAAACCATTGAAATCTTGATCGATCGTCCAATTCTGTGA
AA sequence
>Lus10023263 pacid=23180917 polypeptide=Lus10023263 locus=Lus10023263.g ID=Lus10023263.BGIv1.0 annot-version=v1.0
MAGQKGKKKAGFYSRKRLPIVFLTGGHSLAHLGQTSGEDSGTIQVLIQTHSPSHSIPILRGCTRRPSSRESCRTLPPHLPARGAGKKGFPCLLLRNPENM
SLWNPTTYQFCFASLPSSYAKCYAMYGFGYNSVSDDFKSIRIVLRKNHRGPAPAEVLSWRKRTWTKLTAESRSFLDLQTIEILIDRPIL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23880 F-box and associated interacti... Lus10023263 0 1
AT3G18370 NTMCTYPE3, ATSY... C2 domain-containing protein (... Lus10009672 7.7 0.6656
AT1G47480 alpha/beta-Hydrolases superfam... Lus10034068 24.9 0.6248
AT4G10955 alpha/beta-Hydrolases superfam... Lus10023072 34.7 0.5971
AT1G05680 UGT74E2 Uridine diphosphate glycosyltr... Lus10006720 79.0 0.5238
AT1G80450 VQ motif-containing protein (.... Lus10020092 96.9 0.5256
AT1G11340 S-locus lectin protein kinase ... Lus10017247 136.3 0.5123
AT2G39210 Major facilitator superfamily ... Lus10038682 237.8 0.4714
AT5G38460 ALG6, ALG8 glycosyltransferase... Lus10033554 253.0 0.4651

Lus10023263 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.