Lus10023276 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G05430 145 / 6e-45 Carbohydrate-binding X8 domain superfamily protein (.1)
AT5G56590 116 / 1e-30 O-Glycosyl hydrolases family 17 protein (.1)
AT1G09460 108 / 2e-28 Carbohydrate-binding X8 domain superfamily protein (.1)
AT4G29360 108 / 7e-28 O-Glycosyl hydrolases family 17 protein (.1.2)
AT1G66250 107 / 3e-27 O-Glycosyl hydrolases family 17 protein (.1)
AT1G11820 106 / 5e-27 O-Glycosyl hydrolases family 17 protein (.1.2)
AT1G29380 103 / 6e-27 Carbohydrate-binding X8 domain superfamily protein (.1)
AT2G30933 101 / 1e-26 Carbohydrate-binding X8 domain superfamily protein (.1.2)
AT1G66870 97 / 2e-26 Carbohydrate-binding X8 domain superfamily protein (.1)
AT5G35740 95 / 2e-25 Carbohydrate-binding X8 domain superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038529 339 / 2e-120 AT4G05430 146 / 9e-45 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10012937 124 / 1e-33 AT5G56590 617 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10034987 117 / 3e-31 AT5G56590 562 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10004546 102 / 2e-26 AT1G29380 175 / 2e-52 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10015151 104 / 3e-26 AT2G05790 731 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10004600 102 / 4e-26 AT1G29380 168 / 7e-50 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10007342 100 / 4e-26 AT2G30933 167 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10031456 102 / 1e-25 AT1G11820 796 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10018306 100 / 7e-25 AT5G55180 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G012000 197 / 4e-65 AT4G05430 155 / 3e-49 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.007G111000 193 / 2e-63 AT4G05430 148 / 5e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.019G007800 191 / 1e-62 AT4G05430 160 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.018G068600 130 / 1e-35 AT5G56590 685 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.005G003500 108 / 1e-27 AT2G30933 142 / 1e-38 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.013G003500 108 / 1e-27 AT1G09460 144 / 3e-38 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.001G353400 104 / 4e-27 AT1G29380 144 / 1e-40 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.017G055700 101 / 6e-27 AT4G13600 152 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.011G078500 103 / 1e-26 AT1G29380 154 / 1e-44 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.002G059600 101 / 1e-26 AT2G30933 164 / 5e-50 Carbohydrate-binding X8 domain superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07983 X8 X8 domain
Representative CDS sequence
>Lus10023276 pacid=23181089 polypeptide=Lus10023276 locus=Lus10023276.g ID=Lus10023276.BGIv1.0 annot-version=v1.0
ATGACGACATTCAGGAAGAAGAACAAGATGATCCCCATGCTTGCCTACTTGCAATGCGCCTTCTTTCTCGCACAATCATTCCACTTCGGCAACGCGCGGG
GGATTGAGGCGGCGGCGGAGAGGGTGGAGGGGGCGATTCCGATGACGACGTCCTCGCCGCCGGAAGGGAATACGACGTTCCTGGACGGGACGACGTGGTG
CGTGGCGGCGGCAGGGGCGCCACAGATAGATCTGCAGAAGGCATTGGACTGGGCGTGTGGGTTGGGAATGGCGGAGTGTAAGGAGATTCAGGAGGAAGGA
GCGTGCTTTCACCCCAACAACTTGGTCTCCCACGCTTCCTACGCTTTCAATAGCTATTACCAGCAGAATGGCAACTCCGACATCGCCTGTAACTTCGGCG
GCGCTGCTTCACTTACCAAACACGACCCCAGTTATGGGAAGTGCATATATGCATCAGCTGGATCTGTTGGGTGGGGAACTGAGTTGAGACCAGAGGTTGG
AATATGGTGGAAGTTTGCTGTGATTCTGATGCTATTGTACTGGCAAACTAGCTAG
AA sequence
>Lus10023276 pacid=23181089 polypeptide=Lus10023276 locus=Lus10023276.g ID=Lus10023276.BGIv1.0 annot-version=v1.0
MTTFRKKNKMIPMLAYLQCAFFLAQSFHFGNARGIEAAAERVEGAIPMTTSSPPEGNTTFLDGTTWCVAAAGAPQIDLQKALDWACGLGMAECKEIQEEG
ACFHPNNLVSHASYAFNSYYQQNGNSDIACNFGGAASLTKHDPSYGKCIYASAGSVGWGTELRPEVGIWWKFAVILMLLYWQTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G05430 Carbohydrate-binding X8 domain... Lus10023276 0 1
AT4G05430 Carbohydrate-binding X8 domain... Lus10038529 1.0 0.9593
Lus10025868 4.9 0.9440
Lus10010378 5.7 0.9434
AT1G07400 HSP20-like chaperones superfam... Lus10021503 6.5 0.9338
AT2G36650 unknown protein Lus10014389 7.4 0.9398
Lus10032860 9.2 0.9401
AT5G04890 RTM2 RESTRICTED TEV MOVEMENT 2, HSP... Lus10028874 10.4 0.9349
AT1G07400 HSP20-like chaperones superfam... Lus10021109 12.2 0.9257
AT2G36650 unknown protein Lus10023883 13.7 0.9253
AT5G63710 Leucine-rich repeat protein ki... Lus10025703 14.7 0.9244

Lus10023276 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.