Lus10023279 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07220 197 / 2e-62 ATBAG3 BCL-2-associated athanogene 3 (.1)
AT5G62100 195 / 9e-62 ATBAG2 BCL-2-associated athanogene 2 (.1.2.3)
AT5G52060 179 / 4e-55 ATBAG1 BCL-2-associated athanogene 1 (.1)
AT3G51780 147 / 3e-43 ATBAG4 BCL-2-associated athanogene 4 (.1)
AT5G40630 98 / 2e-25 Ubiquitin-like superfamily protein (.1)
AT5G14360 95 / 2e-24 Ubiquitin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038882 209 / 5e-67 AT5G52060 327 / 1e-111 BCL-2-associated athanogene 1 (.1)
Lus10027420 208 / 2e-66 AT5G52060 349 / 6e-120 BCL-2-associated athanogene 1 (.1)
Lus10015004 205 / 3e-65 AT5G52060 333 / 4e-114 BCL-2-associated athanogene 1 (.1)
Lus10005772 169 / 5e-51 AT5G52060 304 / 2e-102 BCL-2-associated athanogene 1 (.1)
Lus10027822 150 / 3e-44 AT3G51780 221 / 4e-71 BCL-2-associated athanogene 4 (.1)
Lus10005051 152 / 6e-44 AT3G51780 221 / 1e-69 BCL-2-associated athanogene 4 (.1)
Lus10029598 148 / 6e-44 AT5G52060 195 / 8e-61 BCL-2-associated athanogene 1 (.1)
Lus10006328 141 / 4e-41 AT5G52060 194 / 2e-60 BCL-2-associated athanogene 1 (.1)
Lus10003393 109 / 8e-29 AT3G51780 180 / 5e-56 BCL-2-associated athanogene 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G358200 296 / 4e-102 AT5G07220 207 / 9e-66 BCL-2-associated athanogene 3 (.1)
Potri.015G135500 204 / 2e-64 AT5G52060 303 / 2e-101 BCL-2-associated athanogene 1 (.1)
Potri.012G133400 202 / 1e-63 AT5G52060 305 / 2e-102 BCL-2-associated athanogene 1 (.1)
Potri.001G279500 184 / 5e-58 AT3G51780 210 / 2e-67 BCL-2-associated athanogene 4 (.1)
Potri.003G121500 177 / 8e-55 AT5G52060 243 / 1e-78 BCL-2-associated athanogene 1 (.1)
Potri.009G074300 172 / 5e-53 AT3G51780 196 / 4e-62 BCL-2-associated athanogene 4 (.1)
Potri.001G110300 164 / 5e-49 AT5G52060 239 / 2e-76 BCL-2-associated athanogene 1 (.1)
Potri.016G121200 137 / 2e-39 AT3G51780 218 / 1e-70 BCL-2-associated athanogene 4 (.1)
Potri.001G339100 91 / 1e-22 AT5G14360 166 / 6e-53 Ubiquitin-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
CL0072 PF02179 BAG BAG domain
Representative CDS sequence
>Lus10023279 pacid=23181031 polypeptide=Lus10023279 locus=Lus10023279.g ID=Lus10023279.BGIv1.0 annot-version=v1.0
ATGAAGGATGATGAAGTGGAGTGGGAGATGAGACCGGGAGGGATGTTGGTCCAGAAGCGGCCGGAGAAGAGCGAGGCTCCGGCGCCTCCGGGCATTCGGA
TTCGAGTTGCTTACGGTGCTCTCCGTTACCAGATCTCGGTGAACTCTCAGGCCACGTTTGGGGAAGTGAAGAAGCTGTTGAAGGAGGAAACAGGGTTAGA
GGCAGGGGACCAGCGGGTGACGTTCAGAGGGAAAGATCGTCGTGACGGAGACTATCTCGACGCTTGCGGAGTCAAAGACCGATCCAAGATCGTCGTAACG
GAGGATCCTTGTAGCATCGAGCGGAGGTACATGGAGATGCGGAAGAATGCCAGAATCCAGAGGTCACTTCGCACCATCTCCGACATCTGCATGGAGATTG
ATAAGCTCGCCGACCAGGTTAGTGCCATGGAGGAGTCGATATCGGAACGTAAAAAGGTGCCGGAAGTACAGATTTCGACGTTGATGGAGGTTTTGATGAG
GCAAGCTATTAGGCTTGATGAGATTTCTGCCGAAGGGGATGCTTCTTCTCAGCAGATCATTCAGAGCAAGAGGGTGCAAAAATGCGTGGAGAGACTGGAC
GAACTCAAGGTAACGAATGCAAAGGTTGAAGCAGCAACCAAGTGTAAATGGGAGACCTTCGATCCTCCTCTACTTACTCCTTCTCAATGGCAGTTCTTCA
ATTGA
AA sequence
>Lus10023279 pacid=23181031 polypeptide=Lus10023279 locus=Lus10023279.g ID=Lus10023279.BGIv1.0 annot-version=v1.0
MKDDEVEWEMRPGGMLVQKRPEKSEAPAPPGIRIRVAYGALRYQISVNSQATFGEVKKLLKEETGLEAGDQRVTFRGKDRRDGDYLDACGVKDRSKIVVT
EDPCSIERRYMEMRKNARIQRSLRTISDICMEIDKLADQVSAMEESISERKKVPEVQISTLMEVLMRQAIRLDEISAEGDASSQQIIQSKRVQKCVERLD
ELKVTNAKVEAATKCKWETFDPPLLTPSQWQFFN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G07220 ATBAG3 BCL-2-associated athanogene 3 ... Lus10023279 0 1
AT1G58070 unknown protein Lus10019953 1.0 0.9915
AT3G17980 AtC2 Arabidopsis thaliana C2 domain... Lus10018005 3.2 0.9813
AT2G47010 unknown protein Lus10007453 3.5 0.9811
AT4G13940 MEE58, EMB1395,... MATERNAL EFFECT EMBRYO ARREST ... Lus10032593 3.7 0.9852
AT5G61750 RmlC-like cupins superfamily p... Lus10022071 4.6 0.9834
AT2G47180 ATGOLS1 galactinol synthase 1 (.1) Lus10029145 4.7 0.9760
AT3G62020 GLP10 germin-like protein 10 (.1.2) Lus10009254 5.3 0.9825
AT1G05675 UDP-Glycosyltransferase superf... Lus10010468 6.7 0.9520
AT3G57450 unknown protein Lus10029496 7.2 0.9612
AT3G14920 Peptide-N4-(N-acetyl-beta-gluc... Lus10025775 7.3 0.9679

Lus10023279 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.