Lus10023282 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G30370 86 / 5e-20 DLAH DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
AT4G16820 47 / 9e-07 PLA-I{beta]2 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1)
AT2G30550 41 / 0.0001 alpha/beta-Hydrolases superfamily protein (.1.2)
AT1G06800 40 / 0.0002 PLA-I{gamma}1 phospholipase A I gamma 1, alpha/beta-Hydrolases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038526 181 / 4e-55 AT1G30370 539 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
Lus10023280 174 / 2e-52 AT1G30370 537 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
Lus10038524 94 / 3e-23 AT1G30370 526 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
Lus10015521 87 / 1e-20 AT1G30370 524 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
Lus10023281 76 / 8e-17 AT1G30370 342 / 2e-113 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
Lus10004364 51 / 7e-08 AT4G16820 587 / 0.0 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1)
Lus10040158 50 / 9e-08 AT4G16820 573 / 0.0 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1)
Lus10010997 49 / 2e-07 AT4G16820 551 / 0.0 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1)
Lus10025519 46 / 4e-06 AT2G31690 468 / 3e-162 alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G263200 110 / 5e-29 AT1G30370 607 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
Potri.009G057900 106 / 2e-27 AT1G30370 626 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
Potri.001G153100 50 / 7e-08 AT4G16820 575 / 0.0 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1)
Potri.003G081500 48 / 4e-07 AT4G16820 558 / 0.0 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1)
Potri.005G218500 47 / 8e-07 AT1G06800 652 / 0.0 phospholipase A I gamma 1, alpha/beta-Hydrolases superfamily protein (.1.2)
Potri.002G044700 47 / 1e-06 AT1G06800 662 / 0.0 phospholipase A I gamma 1, alpha/beta-Hydrolases superfamily protein (.1.2)
Potri.014G150700 46 / 2e-06 AT2G31690 491 / 7e-172 alpha/beta-Hydrolases superfamily protein (.1)
Potri.002G231600 42 / 6e-05 AT1G05800 524 / 0.0 DONGLE, alpha/beta-Hydrolases superfamily protein (.1)
Potri.009G051900 40 / 0.0004 AT1G51440 700 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Potri.004G054600 39 / 0.0006 AT4G18550 384 / 1e-131 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10023282 pacid=23180931 polypeptide=Lus10023282 locus=Lus10023282.g ID=Lus10023282.BGIv1.0 annot-version=v1.0
ATGGATTCCTCACCGTCGCCGTTAAGCCGGCAAGCCGTCACCGTCAAGTCTCCCTTCCACCAAACTAGGAGAAGAAGCATTAAGGTCTGGAAGATGAAGA
TCAAAGCCAAGTGGCGCTCTTTCACATCCGCATTCTCCCGCAGATTCAAAAGGAGCCGTCTGCACCTCATCCGACGGCAATCACTCCCGCGCCGACGAGA
CAAAACAAACGAGAACAAACCCCTAGGAAACAATAACAGTACCCGCCCGCACAAGTCGCTGGCGAAACTCCTCGAGGTTCCGTACTCCGCCTCGGATTTC
ATCGATTGGGGGGACCGGATGACTCCAACAATATCCCCCAAGAGGGATATTTCGTCGCATTGGCGGGAGTTTCACGGAGAAGGTGATTGGACCGGCGATC
TCCTCAGTCCGCTTCACCCCTGCCTCCGCCGTGAGATTGTCAAGTACGGCTAG
AA sequence
>Lus10023282 pacid=23180931 polypeptide=Lus10023282 locus=Lus10023282.g ID=Lus10023282.BGIv1.0 annot-version=v1.0
MDSSPSPLSRQAVTVKSPFHQTRRRSIKVWKMKIKAKWRSFTSAFSRRFKRSRLHLIRRQSLPRRRDKTNENKPLGNNNSTRPHKSLAKLLEVPYSASDF
IDWGDRMTPTISPKRDISSHWREFHGEGDWTGDLLSPLHPCLRREIVKYG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G30370 DLAH DAD1-like acylhydrolase, alpha... Lus10023282 0 1
AT1G30370 DLAH DAD1-like acylhydrolase, alpha... Lus10038524 2.0 0.9693
AT3G23250 MYB ATMYB15, ATY19 myb domain protein 15 (.1.2) Lus10041145 2.6 0.9700
AT1G51760 JR3, IAR3 JASMONIC ACID RESPONSIVE 3, IA... Lus10030828 3.0 0.9584
AT3G12500 PR-3, PR3, CHI-... PATHOGENESIS-RELATED 3, basic ... Lus10028378 15.6 0.9553
AT2G02010 GAD4 glutamate decarboxylase 4 (.1) Lus10019136 18.7 0.9295
AT1G20870 HSP20-like chaperones superfam... Lus10018368 19.1 0.9417
AT2G32030 Acyl-CoA N-acyltransferases (N... Lus10010570 21.9 0.9483
AT1G21326 VQ motif-containing protein (.... Lus10029768 23.2 0.9165
AT3G56710 SIB1 sigma factor binding protein 1... Lus10039493 28.5 0.9229
AT1G30370 DLAH DAD1-like acylhydrolase, alpha... Lus10015521 28.5 0.9491

Lus10023282 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.