Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G30260 60 / 2e-13 AGL79 unknown protein AT4G21060 48 / 5e-08 Galactosyltransferase family protein (.1.2) AT3G14395 34 / 0.001 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038517 [exp] 114 / 4e-35 AT1G30260 61 / 1e-13 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G081001 [exp] 68 / 8e-17 AT1G30260 68 / 2e-16 unknown protein Potri.004G133180 [exp] 66 / 5e-16 AT1G30260 61 / 1e-13 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023289 pacid=23180949 polypeptide=Lus10023289 locus=Lus10023289.g ID=Lus10023289.BGIv1.0 annot-version=v1.0 ATGGCGAATGCACGCATAGCAAAGTTCGTGACAGAGGTGGCGCCTCCGCAGTACATTAAGGTGATGAGGAACAGAGCTACCAAGATGCTCGATACCATCA AGGAAGACGATCGATCTGATCATAACGTTGCTTCACAAACTAGTACTAGTAGTCCTGTTTCGAAATCGAAGTCGTCGTCGGGTTACTTCCTAGCTGGGAT GCGCCAGCAATCACTTTTTGATCTCTGA
AA sequence Show only first row Show all	>Lus10023289 pacid=23180949 polypeptide=Lus10023289 locus=Lus10023289.g ID=Lus10023289.BGIv1.0 annot-version=v1.0 MANARIAKFVTEVAPPQYIKVMRNRATKMLDTIKEDDRSDHNVASQTSTSSPVSKSKSSSGYFLAGMRQQSLFDL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G30260		AGL79	unknown protein		Lus10023289 [exp]	0	1
AT1G30260		AGL79	unknown protein		Lus10038517 [exp]	1.7	0.8810
AT4G21500			unknown protein		Lus10018431 [exp]	6.9	0.8064
AT1G19670		CORI1, ATHCOR1,...	CORONATINE-INDUCED PROTEIN 1, ...		Lus10004076 [exp]	8.5	0.8461
AT3G58720			RING/U-box superfamily protein...		Lus10040151 [exp]	11.8	0.8488
AT1G29390		COR413IM2, COR3...	COLD REGULATED 314 INNER MEMBR...		Lus10025378 [exp]	13.3	0.8623
AT1G47480			alpha/beta-Hydrolases superfam...		Lus10019884 [exp]	14.2	0.8598
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10015287 [exp]	17.0	0.8505
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10008529 [exp]	17.3	0.8379
AT2G23180		CYP96A1	"cytochrome P450, family 96, s...		Lus10025677 [exp]	17.8	0.8584
AT2G45350		CRR4	CHLORORESPIRATORY REDUCTION 4,...		Lus10015874 [exp]	23.5	0.8571

Compare expression of checked genes

Lus10023289 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.