Lus10023291 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18400 75 / 1e-18 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G133260 75 / 8e-19 AT4G18400 90 / 1e-24 unknown protein
PFAM info
Representative CDS sequence
>Lus10023291 pacid=23180926 polypeptide=Lus10023291 locus=Lus10023291.g ID=Lus10023291.BGIv1.0 annot-version=v1.0
ATGCCTGGAGATGAAACACCGCCTCCCGCCGATGCCGTCTCTGCCCCACCAGAAACCGGATCAAATCCGCCATCCCCTCCACCAGAATCCAATCCTCCGC
CGCCTCCTTCGTTCGATCCCAGCCGCAGTATAATCAAAAGGAAGACGTTGATTAAAGAGCTGGCGGCAGTGTACCACGCTGAGTGCCTCACGTACTGTCG
AGAGCTTTTGGAGCTGCAGAATAAATCAGCGGAAGAGCCATTTCTGGATTCAAAGCCTCCTGAAGATTCAAGGAAAGAGATTTCCAGACCCACTAAACGC
TCAAAGAAGGGCAGATAG
AA sequence
>Lus10023291 pacid=23180926 polypeptide=Lus10023291 locus=Lus10023291.g ID=Lus10023291.BGIv1.0 annot-version=v1.0
MPGDETPPPADAVSAPPETGSNPPSPPPESNPPPPPSFDPSRSIIKRKTLIKELAAVYHAECLTYCRELLELQNKSAEEPFLDSKPPEDSRKEISRPTKR
SKKGR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18400 unknown protein Lus10023291 0 1
AT3G57990 unknown protein Lus10012013 5.1 0.7431
AT1G23050 hydroxyproline-rich glycoprote... Lus10043476 7.1 0.7222
AT3G54680 proteophosphoglycan-related (.... Lus10033654 14.4 0.6952
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Lus10038866 16.9 0.7211
Lus10014600 17.1 0.7195
AT5G42190 SKP1B, ASK2 Arabidopsis SKP-like 2, E3 ubi... Lus10017281 21.0 0.7164
AT5G40190 RNA ligase/cyclic nucleotide p... Lus10032164 21.1 0.7053
AT1G30440 Phototropic-responsive NPH3 fa... Lus10023274 34.3 0.6748
AT1G55460 C2H2ZnF DNA/RNA-binding protein Kin17,... Lus10005161 36.2 0.6924
AT5G58020 unknown protein Lus10036615 43.2 0.7035

Lus10023291 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.