Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023294 [exp] 125 / 3e-38 AT1G22590 52 / 2e-09 AGAMOUS-like 87 (.1.2) Lus10000974 [exp] 84 / 4e-21 AT5G26650 93 / 3e-24 AGAMOUS-like 36 (.1) Lus10028653 [exp] 73 / 4e-17 AT1G22590 91 / 2e-23 AGAMOUS-like 87 (.1.2) Lus10032108 [exp] 40 / 0.0002 AT5G48670 180 / 9e-55 AGAMOUS-like 80 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G068132 [exp] 52 / 8e-09 AT5G48670 125 / 1e-34 AGAMOUS-like 80 (.1) Potri.006G201700 [exp] 50 / 3e-08 AT5G48670 120 / 2e-30 AGAMOUS-like 80 (.1) Potri.005G002400 [exp] 49 / 1e-07 AT5G48670 222 / 4e-71 AGAMOUS-like 80 (.1) Potri.013G001700 [exp] 40 / 0.0002 AT5G48670 203 / 3e-64 AGAMOUS-like 80 (.1) Potri.013G018100 [exp] 40 / 0.0002 AT5G48670 187 / 1e-58 AGAMOUS-like 80 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023293 pacid=23181042 polypeptide=Lus10023293 locus=Lus10023293.g ID=Lus10023293.BGIv1.0 annot-version=v1.0 ATGGTGAGGAGAAATGTGAAGCTTGAGTTCATCACCGATGAAGTTGCACGAAAAAAGACTTTTGAGAAGAAGAAAATCGAAATATGGAAGGAATTGCAGG AGATGACAGCTCTGTATGGAGTGTGCGCTTCCGTAATCCTCTTCCACAACTTCGCCGAAAATGGCGAAGATGATGGGCCAAAGATAGAAGCTTGGCCATC TGTCCCAGATGCTCTGGAGTTGTTCGATAAGAACAAGGAAGAGCTGAAGATCACTGCGAAGAAGAAGAAGAAGAAGAATCTACGGCAGCTGCGCGAGAAG TTGGTAGCTCTGCGTGAAAAGGTTGCTGAGCGGAATGAATGTATTAAGAAGCAGAATAAAAACGAGTGA
AA sequence Show only first row Show all	>Lus10023293 pacid=23181042 polypeptide=Lus10023293 locus=Lus10023293.g ID=Lus10023293.BGIv1.0 annot-version=v1.0 MVRRNVKLEFITDEVARKKTFEKKKIEIWKELQEMTALYGVCASVILFHNFAENGEDDGPKIEAWPSVPDALELFDKNKEELKITAKKKKKKNLRQLREK LVALREKVAERNECIKKQNKNE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G22590	MADS	AGL87	AGAMOUS-like 87 (.1.2)		Lus10023293 [exp]	0	1
AT5G54160		ATOMT1	O-methyltransferase 1 (.1)		Lus10002667 [exp]	1.0	0.9484
AT1G69480			EXS (ERD1/XPR1/SYG1) family pr...		Lus10004285 [exp]	2.0	0.8470
					Lus10024617 [exp]	2.4	0.8118
					Lus10030116 [exp]	10.0	0.7335
AT5G57500			Galactosyltransferase family p...		Lus10025474 [exp]	15.1	0.6681
AT5G62000	ARF	ORE14, HSS, ARF...	ORESARA 14, HLS1 SUPPRESSOR, A...		Lus10040906 [exp]	22.4	0.7501
					Lus10033096 [exp]	25.7	0.6648
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Lus10030286 [exp]	26.5	0.6648
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10021338 [exp]	27.2	0.6648
AT1G27220			paired amphipathic helix repea...		Lus10000805 [exp]	27.9	0.6648

Compare expression of checked genes

Lus10023293 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.