Lus10023295 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14070 96 / 3e-26 ROXY2 Thioredoxin superfamily protein (.1)
AT3G02000 85 / 5e-22 ROXY1 Thioredoxin superfamily protein (.1)
AT1G28480 80 / 5e-20 roxy19, GRX480 Thioredoxin superfamily protein (.1)
AT1G03850 73 / 3e-17 ATGRXS13 glutaredoxin 13, Glutaredoxin family protein (.1.2)
AT3G21460 71 / 1e-16 Glutaredoxin family protein (.1)
AT4G15700 67 / 4e-15 Thioredoxin superfamily protein (.1)
AT4G15660 67 / 4e-15 Thioredoxin superfamily protein (.1)
AT4G15670 67 / 4e-15 Thioredoxin superfamily protein (.1)
AT4G15690 66 / 5e-15 Thioredoxin superfamily protein (.1)
AT4G15680 65 / 2e-14 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038514 164 / 3e-53 AT5G14070 122 / 2e-36 Thioredoxin superfamily protein (.1)
Lus10041538 96 / 3e-26 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1)
Lus10035183 96 / 4e-26 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1)
Lus10011333 91 / 6e-24 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1)
Lus10013962 82 / 9e-21 AT1G28480 135 / 3e-42 Thioredoxin superfamily protein (.1)
Lus10039867 74 / 2e-17 AT1G28480 127 / 7e-39 Thioredoxin superfamily protein (.1)
Lus10018631 71 / 1e-16 AT1G28480 127 / 8e-39 Thioredoxin superfamily protein (.1)
Lus10033965 70 / 3e-16 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1)
Lus10002887 67 / 2e-15 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G325800 99 / 2e-27 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1)
Potri.003G167000 95 / 6e-26 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1)
Potri.001G060600 94 / 2e-25 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1)
Potri.017G017300 80 / 1e-19 AT1G28480 132 / 3e-40 Thioredoxin superfamily protein (.1)
Potri.004G049800 79 / 3e-19 AT1G28480 94 / 2e-25 Thioredoxin superfamily protein (.1)
Potri.007G134800 79 / 3e-19 AT1G28480 141 / 9e-44 Thioredoxin superfamily protein (.1)
Potri.011G058800 76 / 2e-18 AT1G28480 102 / 2e-28 Thioredoxin superfamily protein (.1)
Potri.008G214500 71 / 1e-16 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1)
Potri.010G021800 67 / 2e-15 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1)
Potri.014G133800 66 / 5e-15 AT1G03020 142 / 1e-45 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00462 Glutaredoxin Glutaredoxin
Representative CDS sequence
>Lus10023295 pacid=23181079 polypeptide=Lus10023295 locus=Lus10023295.g ID=Lus10023295.BGIv1.0 annot-version=v1.0
ATGGCGGCAGCGGCAAACAGCGTGGCGGCGGAAAACGGCGGCGGGTCAACGACAACGTTGGAGAAGAATCACTTTGGCGGCGCGTACGAAGTGGTGGGAG
AGGTAGCGAGGAGCAACGCGGTGGTGGTGTTCAGCATGAGCGGCTGCTGCATGTGCACGGTGGTCAAGCGGCTCCTCTTCGGGCTCGGAGTGGGGCCCAC
GATTGTTGAGCTTGACCACCTTCCTAATTCTTCTGATGACATCCAGGCCGTCCTTGTGGGTCTCCATGGATCCAACGGTGGTGGTGTTGGTGGTGGCACC
GTGCCGGCGGTTTTTGTTGGAGGGAAGTTCGTCGGTGGGATTGAGAGGCTGATGGCTTGCCATATCAATGGGTCCTTGGTGCCTCTTCTCAAGGATGCTG
GTGCTCTCTGGCTTTGA
AA sequence
>Lus10023295 pacid=23181079 polypeptide=Lus10023295 locus=Lus10023295.g ID=Lus10023295.BGIv1.0 annot-version=v1.0
MAAAANSVAAENGGGSTTTLEKNHFGGAYEVVGEVARSNAVVVFSMSGCCMCTVVKRLLFGLGVGPTIVELDHLPNSSDDIQAVLVGLHGSNGGGVGGGT
VPAVFVGGKFVGGIERLMACHINGSLVPLLKDAGALWL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14070 ROXY2 Thioredoxin superfamily protei... Lus10023295 0 1
AT3G09510 Ribonuclease H-like superfamil... Lus10000349 1.7 0.9522
AT2G47940 EMB3117, DEGP2 EMBRYO DEFECTIVE 3117, DEGP pr... Lus10005931 2.2 0.9585
AT2G42800 AtRLP29 receptor like protein 29 (.1) Lus10010946 2.4 0.9581
AT5G13150 ATEXO70C1 exocyst subunit exo70 family p... Lus10011334 5.0 0.9347
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Lus10013915 6.3 0.9227
AT2G35160 SGD9, SUVH5 SET DOMAIN-CONTAINING PROTEIN ... Lus10032528 7.7 0.9492
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10039303 8.9 0.9069
Lus10007141 12.7 0.9002
AT5G11550 ARM repeat superfamily protein... Lus10011691 13.3 0.9245
AT5G47500 PME5 pectin methylesterase 5, Pecti... Lus10004720 13.3 0.9112

Lus10023295 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.