Lus10023305 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G46210 59 / 3e-11 CUL4, ATCUL4 cullin4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G084400 100 / 1e-25 AT5G46210 1250 / 0.0 cullin4 (.1)
Potri.004G132900 91 / 3e-22 AT5G46210 1211 / 0.0 cullin4 (.1)
PFAM info
Representative CDS sequence
>Lus10023305 pacid=23180960 polypeptide=Lus10023305 locus=Lus10023305.g ID=Lus10023305.BGIv1.0 annot-version=v1.0
ATGTCTCTCCCCACCAAACGTTCTGCCACTGCTGCTGCTTCTTCTGCTTCTTCCCCCACCACTTCCTCCGCCGCCGCCTGTTTCCGGCCGCCGATGAAGA
AAGCCAAGTCTCAGGCCTGCTCCTCTCCTCTCGATTCCTCCTCCAATAAAAACGGCCTACACCACTTCACCGCTCCAAATTCCGCCAATACCGATGTCCT
CTTCGACCCTTCCTCCATGTCCCTCGACGAAAATCCTACGCTCGTCGATGCCGCCCCTCCCACCGCCGCTAATTTATCTCGCAAGAAGGCCACTCTCCCT
CAGCCGGCCAAGAAGCTCGTCATCAAGCTCAATAAAGAATTGACTGTATGTAATAGAATGTTAAGAGATGCAGATTCTATGGATCCGAGCTGGCCTTAA
AA sequence
>Lus10023305 pacid=23180960 polypeptide=Lus10023305 locus=Lus10023305.g ID=Lus10023305.BGIv1.0 annot-version=v1.0
MSLPTKRSATAAASSASSPTTSSAAACFRPPMKKAKSQACSSPLDSSSNKNGLHHFTAPNSANTDVLFDPSSMSLDENPTLVDAAPPTAANLSRKKATLP
QPAKKLVIKLNKELTVCNRMLRDADSMDPSWP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G46210 CUL4, ATCUL4 cullin4 (.1) Lus10023305 0 1
AT5G32470 Haem oxygenase-like, multi-hel... Lus10021976 9.3 0.7688
AT3G45190 SIT4 phosphatase-associated fa... Lus10016088 9.5 0.8405
AT1G53730 SRF6 STRUBBELIG-receptor family 6 (... Lus10003926 9.6 0.7760
AT1G67930 Golgi transport complex protei... Lus10020753 11.9 0.8400
AT5G45330 DCP5-L decapping 5-like (.1) Lus10035052 15.0 0.8377
AT1G09020 ATSNF4, SNF4 homolog of yeast sucrose nonfe... Lus10029909 18.5 0.7975
AT3G01810 unknown protein Lus10037001 21.0 0.8034
AT3G47890 Ubiquitin carboxyl-terminal hy... Lus10042186 22.0 0.8172
AT5G22780 Adaptor protein complex AP-2, ... Lus10005371 25.4 0.8283
AT5G41950 Tetratricopeptide repeat (TPR)... Lus10001675 26.5 0.8290

Lus10023305 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.