Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34585 43 / 5e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038503 [exp] 69 / 3e-17 AT2G34585 78 / 9e-21 unknown protein Lus10038559 [exp] 56 / 9e-11 AT2G34585 67 / 1e-14 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G084300 [exp] 61 / 2e-14 AT2G34585 77 / 9e-21 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023307 pacid=23180978 polypeptide=Lus10023307 locus=Lus10023307.g ID=Lus10023307.BGIv1.0 annot-version=v1.0 ATGGGAGCGGTGACGACGGCGATAATAGCGATAGCAGGAGTGATTCTGGGTTGGATCGCCATCGAGATCGCTTGCAAGCCTTGCCTCGATCACGGCCGCC AAGCCATCGACCGATCTCTTAACCCTGACTACGATCCCGATGACGACGCCATTCGTGCCCCTTTGAACCCTCCTTCAAATTCAAATCCTCCCATTCTCGA ATCGCTTTCCTCCTCCTCGGCCAAGGCGATCTGA
AA sequence Show only first row Show all	>Lus10023307 pacid=23180978 polypeptide=Lus10023307 locus=Lus10023307.g ID=Lus10023307.BGIv1.0 annot-version=v1.0 MGAVTTAIIAIAGVILGWIAIEIACKPCLDHGRQAIDRSLNPDYDPDDDAIRAPLNPPSNSNPPILESLSSSSAKAI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G34585			unknown protein		Lus10023307 [exp]	0	1
AT4G34630			unknown protein		Lus10028793 [exp]	4.2	0.8052
AT5G54680	bHLH	bHLH105, ILR3	iaa-leucine resistant3, basic ...		Lus10043076 [exp]	6.0	0.7796
AT2G40810		ATATG18C	homolog of yeast autophagy 18C...		Lus10003694 [exp]	7.1	0.7793
AT2G19270			unknown protein		Lus10020014 [exp]	7.9	0.7379
AT2G02510			NADH dehydrogenase (ubiquinone...		Lus10005182 [exp]	8.0	0.7618
AT5G41940			Ypt/Rab-GAP domain of gyp1p su...		Lus10008872 [exp]	8.5	0.7175
AT3G27310		PUX1	plant UBX domain-containing pr...		Lus10014616 [exp]	10.4	0.7291
AT5G56340		ATCRT1	RING/U-box superfamily protein...		Lus10013397 [exp]	11.1	0.8206
AT4G24210		SLY1	SLEEPY1, F-box family protein ...		Lus10042637 [exp]	11.5	0.7903
AT5G52990			SNARE-like superfamily protein...		Lus10022397 [exp]	12.7	0.7694

Compare expression of checked genes

Lus10023307 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.