Lus10023313 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G29990 175 / 2e-57 PFD6, PDF6 prefoldin 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038496 136 / 3e-42 AT1G29990 155 / 6e-50 prefoldin 6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G131900 181 / 1e-59 AT1G29990 213 / 9e-73 prefoldin 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0200 Prefoldin PF01920 Prefoldin_2 Prefoldin subunit
Representative CDS sequence
>Lus10023313 pacid=23181000 polypeptide=Lus10023313 locus=Lus10023313.g ID=Lus10023313.BGIv1.0 annot-version=v1.0
ATGGCATCCCCAGCCGCCGTTAGAGAATTGCAGCGCGATCTCGAAAACAAAGCTAACGATCTCAGCAAAATCCAGAAAGGCAAGCTTTCCGAACACTCCC
CAAATTCTCTGAATATTGCAAAGAATCACCAAGTGAGGAAGAAGTACACTATCCAGCTTGGTGAGAACGAGCTTGTGCTGAAGGAGCTGGAATTGTTGAG
AGAGGATGCAAATGTTTTCAAACTGATTGGTCCGGTGCTGGTGAAGCAAGATTTGGCTGAGGCTAATGCCAACGTCCGTAAGAGGATTGAGTATATATCT
GCTGAGTTGAAGCGACATGATGCAACTCTTCAAGATCTGGAAGAAAAGCAGAACAGCAAAAGAGAGGCGGTGATGAAGGTACAGCAAAGAATCCAATCCC
TTCAGGCTGGAAAAGGAAAAGCATAG
AA sequence
>Lus10023313 pacid=23181000 polypeptide=Lus10023313 locus=Lus10023313.g ID=Lus10023313.BGIv1.0 annot-version=v1.0
MASPAAVRELQRDLENKANDLSKIQKGKLSEHSPNSLNIAKNHQVRKKYTIQLGENELVLKELELLREDANVFKLIGPVLVKQDLAEANANVRKRIEYIS
AELKRHDATLQDLEEKQNSKREAVMKVQQRIQSLQAGKGKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G29990 PFD6, PDF6 prefoldin 6 (.1) Lus10023313 0 1
AT2G43780 unknown protein Lus10037305 2.0 0.8524
AT1G20430 unknown protein Lus10034561 2.4 0.8626
AT1G32210 ATDAD1 DEFENDER AGAINST APOPTOTIC DEA... Lus10010413 3.2 0.8517
AT3G18760 Translation elongation factor... Lus10038301 3.9 0.8673
AT2G43780 unknown protein Lus10035718 6.7 0.8336
AT5G51960 unknown protein Lus10036504 7.1 0.8458
AT3G62810 complex 1 family protein / LVR... Lus10021599 8.6 0.8105
AT3G06610 DNA-binding enhancer protein-r... Lus10037773 10.8 0.8487
AT1G27695 glycine-rich protein (.1.2) Lus10032855 11.0 0.8450
AT5G37590 Tetratricopeptide repeat (TPR)... Lus10020809 12.0 0.8524

Lus10023313 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.