Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34430 182 / 3e-59 LHCB1.4, LHB1B1 light-harvesting chlorophyll-protein complex II subunit B1 (.1) AT2G34420 181 / 5e-59 LHCB1.5, LHB1B2 PHOTOSYSTEM II LIGHT HARVESTING COMPLEX GENE 1.5, photosystem II light harvesting complex gene B1B2 (.1) AT1G29930 181 / 7e-59 LHCB1.3, CAB140, CAB1 LIGHT-HARVESTING CHLOROPHYLL A/B-PROTEIN 1.3, CHLOROPHYLL A/B PROTEIN 140, chlorophyll A/B binding protein 1 (.1) AT1G29920 181 / 8e-59 AB165, LHCB1.1, CAB2 LIGHT HARVESTING CHLOROPHYLL A/B-BINDING PROTEIN 1.1, chlorophyll A/B-binding protein 2 (.1) AT1G29910 181 / 8e-59 AB180, LHCB1.2, CAB3 LIGHT HARVESTING CHLOROPHYLL A/B BINDING PROTEIN 1.2, chlorophyll A/B binding protein 3 (.1) AT3G27690 175 / 2e-56 LHCB2.3, LHCB2:4 LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2, photosystem II light harvesting complex gene 2.3 (.1) AT2G05070 173 / 7e-56 LHCB2.2 LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2, photosystem II light harvesting complex gene 2.2 (.1) AT2G05100 171 / 5e-55 LHCB2.3, LHCB2.1 LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2, photosystem II light harvesting complex gene 2.1 (.1) AT5G54270 142 / 9e-44 LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, light-harvesting chlorophyll B-binding protein 3 (.1) AT4G10340 108 / 2e-30 LHCB5 light harvesting complex of photosystem II 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023322 [exp] 199 / 6e-67 AT1G29930 242 / 5e-81 LIGHT-HARVESTING CHLOROPHYLL A/B-PROTEIN 1.3, CHLOROPHYLL A/B PROTEIN 140, chlorophyll A/B binding protein 1 (.1) Lus10038490 [exp] 199 / 1e-66 AT1G29910 337 / 2e-118 LIGHT HARVESTING CHLOROPHYLL A/B BINDING PROTEIN 1.2, chlorophyll A/B binding protein 3 (.1) Lus10038489 [exp] 197 / 1e-66 AT2G34430 301 / 4e-105 light-harvesting chlorophyll-protein complex II subunit B1 (.1) Lus10008191 [exp] 199 / 5e-66 AT1G29910 452 / 5e-163 LIGHT HARVESTING CHLOROPHYLL A/B BINDING PROTEIN 1.2, chlorophyll A/B binding protein 3 (.1) Lus10007362 [exp] 197 / 1e-65 AT1G29930 370 / 5e-131 LIGHT-HARVESTING CHLOROPHYLL A/B-PROTEIN 1.3, CHLOROPHYLL A/B PROTEIN 140, chlorophyll A/B binding protein 1 (.1) Lus10027966 [exp] 198 / 2e-65 AT1G29910 446 / 2e-160 LIGHT HARVESTING CHLOROPHYLL A/B BINDING PROTEIN 1.2, chlorophyll A/B binding protein 3 (.1) Lus10042219 [exp] 198 / 2e-65 AT1G29930 444 / 1e-159 LIGHT-HARVESTING CHLOROPHYLL A/B-PROTEIN 1.3, CHLOROPHYLL A/B PROTEIN 140, chlorophyll A/B binding protein 1 (.1) Lus10008594 [exp] 197 / 6e-65 AT1G29930 445 / 4e-160 LIGHT-HARVESTING CHLOROPHYLL A/B-PROTEIN 1.3, CHLOROPHYLL A/B PROTEIN 140, chlorophyll A/B binding protein 1 (.1) Lus10001741 [exp] 184 / 4e-60 AT3G27690 481 / 1e-174 LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2, photosystem II light harvesting complex gene 2.3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G189300 [exp] 195 / 2e-64 AT2G34430 448 / 2e-161 light-harvesting chlorophyll-protein complex II subunit B1 (.1) Potri.005G239300 [exp] 193 / 9e-64 AT2G34430 485 / 4e-176 light-harvesting chlorophyll-protein complex II subunit B1 (.1) Potri.005G239200 [exp] 192 / 4e-63 AT2G34430 484 / 2e-175 light-harvesting chlorophyll-protein complex II subunit B1 (.1) Potri.011G079500 [exp] 191 / 1e-62 AT2G34430 480 / 6e-174 light-harvesting chlorophyll-protein complex II subunit B1 (.1) Potri.014G165100 [exp] 178 / 9e-58 AT2G05100 507 / 0.0 LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2, photosystem II light harvesting complex gene 2.1 (.1) Potri.002G221400 [exp] 177 / 2e-57 AT2G05070 499 / 0.0 LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2, photosystem II light harvesting complex gene 2.2 (.1) Potri.011G126700 [exp] 144 / 6e-45 AT5G54270 446 / 3e-161 light-harvesting chlorophyll B-binding protein 3 (.1) Potri.001G407100 [exp] 145 / 8e-45 AT5G54270 478 / 2e-173 light-harvesting chlorophyll B-binding protein 3 (.1) Potri.019G063101 [exp] 103 / 2e-28 AT4G10340 409 / 2e-145 light harvesting complex of photosystem II 5 (.1) Potri.005G258600 [exp] 96 / 5e-25 AT1G76570 491 / 6e-176 Chlorophyll A-B binding family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00504 [flax] [poplar] Chloroa_b-bind Chlorophyll A-B binding protein
Representative CDS sequence Show only first row Show all	>Lus10023320 pacid=23181101 polypeptide=Lus10023320 locus=Lus10023320.g ID=Lus10023320.BGIv1.0 annot-version=v1.0 ATGGGGGCTGTTGAAGGATACCGTGTTGCTGGAGGCCCACTTGGGGAGGTCGTTGACCCGCTTTACCCCGGTGGCAGCTTCGACCCATTGGGTCTTGCCG ACGACCCGGAGGCTTTTGCTGAGTTGAAGGTGAAGGAGATCAAGAACGGTAGGTTGGCTATGTTCTCCATGTTCGGGTTCTTCGTTCAGGCTATTGTTAC TGGAAAGGGACCGTTGGAGAACTTGGCTGACCACATCACCGATCCAGTCAACAACAATGCCTGGGCTTTTGCCACCAACTTCGTCCCCGGAAAGTGA
AA sequence Show only first row Show all	>Lus10023320 pacid=23181101 polypeptide=Lus10023320 locus=Lus10023320.g ID=Lus10023320.BGIv1.0 annot-version=v1.0 MGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHITDPVNNNAWAFATNFVPGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G34430		LHCB1.4, LHB1B1	light-harvesting chlorophyll-p...		Lus10023320 [exp]	0	1
AT2G30570		PSBW	photosystem II reaction center...		Lus10033862 [exp]	2.0	0.9557
AT3G08940		LHCB4.2	light harvesting complex photo...		Lus10027786 [exp]	3.0	0.9458
AT2G06520		PSBX	photosystem II subunit X (.1)		Lus10025007 [exp]	3.2	0.9465
AT4G34190		SEP1	stress enhanced protein 1 (.1)		Lus10027871 [exp]	3.9	0.9267
AT1G29930		LHCB1.3, CAB140...	LIGHT-HARVESTING CHLOROPHYLL A...		Lus10042219 [exp]	4.0	0.9400
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10015831 [exp]	5.0	0.9421
AT1G61520		LHCA3*1, LHCA3*...	photosystem I light harvesting...		Lus10012297 [exp]	7.5	0.9407
AT1G72640			NAD(P)-binding Rossmann-fold s...		Lus10016517 [exp]	8.0	0.9455
AT1G55670		PSAG	photosystem I subunit G (.1)		Lus10017476 [exp]	10.1	0.9420
AT3G61470		LHCA2	photosystem I light harvesting...		Lus10011361 [exp]	10.4	0.9388

Compare expression of checked genes

Lus10023320 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.