Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29920 156 / 2e-48 AB165, LHCB1.1, CAB2 LIGHT HARVESTING CHLOROPHYLL A/B-BINDING PROTEIN 1.1, chlorophyll A/B-binding protein 2 (.1) AT1G29910 156 / 2e-48 AB180, LHCB1.2, CAB3 LIGHT HARVESTING CHLOROPHYLL A/B BINDING PROTEIN 1.2, chlorophyll A/B binding protein 3 (.1) AT1G29930 155 / 3e-48 LHCB1.3, CAB140, CAB1 LIGHT-HARVESTING CHLOROPHYLL A/B-PROTEIN 1.3, CHLOROPHYLL A/B PROTEIN 140, chlorophyll A/B binding protein 1 (.1) AT2G34420 151 / 1e-46 LHCB1.5, LHB1B2 PHOTOSYSTEM II LIGHT HARVESTING COMPLEX GENE 1.5, photosystem II light harvesting complex gene B1B2 (.1) AT2G34430 148 / 2e-45 LHCB1.4, LHB1B1 light-harvesting chlorophyll-protein complex II subunit B1 (.1) AT2G05100 139 / 9e-42 LHCB2.3, LHCB2.1 LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2, photosystem II light harvesting complex gene 2.1 (.1) AT3G27690 137 / 4e-41 LHCB2.3, LHCB2:4 LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2, photosystem II light harvesting complex gene 2.3 (.1) AT2G05070 136 / 7e-41 LHCB2.2 LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2, photosystem II light harvesting complex gene 2.2 (.1) AT5G54270 124 / 2e-36 LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, light-harvesting chlorophyll B-binding protein 3 (.1) AT1G76570 84 / 3e-20 Chlorophyll A-B binding family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008191 [exp] 180 / 8e-58 AT1G29910 452 / 5e-163 LIGHT HARVESTING CHLOROPHYLL A/B BINDING PROTEIN 1.2, chlorophyll A/B binding protein 3 (.1) Lus10027966 [exp] 175 / 5e-56 AT1G29910 446 / 2e-160 LIGHT HARVESTING CHLOROPHYLL A/B BINDING PROTEIN 1.2, chlorophyll A/B binding protein 3 (.1) Lus10008594 [exp] 172 / 8e-55 AT1G29930 445 / 4e-160 LIGHT-HARVESTING CHLOROPHYLL A/B-PROTEIN 1.3, CHLOROPHYLL A/B PROTEIN 140, chlorophyll A/B binding protein 1 (.1) Lus10042219 [exp] 172 / 8e-55 AT1G29930 444 / 1e-159 LIGHT-HARVESTING CHLOROPHYLL A/B-PROTEIN 1.3, CHLOROPHYLL A/B PROTEIN 140, chlorophyll A/B binding protein 1 (.1) Lus10038490 [exp] 155 / 7e-49 AT1G29910 337 / 2e-118 LIGHT HARVESTING CHLOROPHYLL A/B BINDING PROTEIN 1.2, chlorophyll A/B binding protein 3 (.1) Lus10023322 [exp] 144 / 2e-44 AT1G29930 242 / 5e-81 LIGHT-HARVESTING CHLOROPHYLL A/B-PROTEIN 1.3, CHLOROPHYLL A/B PROTEIN 140, chlorophyll A/B binding protein 1 (.1) Lus10001169 [exp] 140 / 4e-42 AT3G27690 484 / 1e-175 LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2, photosystem II light harvesting complex gene 2.3 (.1) Lus10001741 [exp] 138 / 2e-41 AT3G27690 481 / 1e-174 LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2, photosystem II light harvesting complex gene 2.3 (.1) Lus10038575 [exp] 130 / 2e-38 AT5G54270 462 / 9e-167 light-harvesting chlorophyll B-binding protein 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G079500 [exp] 158 / 2e-49 AT2G34430 480 / 6e-174 light-harvesting chlorophyll-protein complex II subunit B1 (.1) Potri.005G239300 [exp] 156 / 1e-48 AT2G34430 485 / 4e-176 light-harvesting chlorophyll-protein complex II subunit B1 (.1) Potri.005G239200 [exp] 156 / 1e-48 AT2G34430 484 / 2e-175 light-harvesting chlorophyll-protein complex II subunit B1 (.1) Potri.002G189300 [exp] 148 / 2e-45 AT2G34430 448 / 2e-161 light-harvesting chlorophyll-protein complex II subunit B1 (.1) Potri.014G165100 [exp] 138 / 9e-42 AT2G05100 507 / 0.0 LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2, photosystem II light harvesting complex gene 2.1 (.1) Potri.002G221400 [exp] 137 / 3e-41 AT2G05070 499 / 0.0 LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2, photosystem II light harvesting complex gene 2.2 (.1) Potri.001G407100 [exp] 129 / 6e-38 AT5G54270 478 / 2e-173 light-harvesting chlorophyll B-binding protein 3 (.1) Potri.011G126700 [exp] 126 / 2e-37 AT5G54270 446 / 3e-161 light-harvesting chlorophyll B-binding protein 3 (.1) Potri.005G258600 [exp] 88 / 8e-22 AT1G76570 491 / 6e-176 Chlorophyll A-B binding family protein (.1) Potri.019G063101 [exp] 76 / 2e-17 AT4G10340 409 / 2e-145 light harvesting complex of photosystem II 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00504 [flax] [poplar] Chloroa_b-bind Chlorophyll A-B binding protein
Representative CDS sequence Show only first row Show all	>Lus10023321 pacid=23181056 polypeptide=Lus10023321 locus=Lus10023321.g ID=Lus10023321.BGIv1.0 annot-version=v1.0 ATGGCAGCCTCAACCATGGCTCTGTCTTCCTCCACCTTCGCCGGAAAGTCCGCCGGACTTTCCCCCAAATCCGTATCGGGAGGCAGCCGCATCATGATGA GGAAGACATCAGCAAAGGCCAAGCAGGTCTCATCCGGAAGCCCATGGTACGGCCCAGACCGCGTCAAGTACTTGGGCCCATTCTCTGGCGAAGCCCCTTC CTACTTGACCGGCGAGTTCCCCGGTGACTACGGCTGGGACACCCCCGGCCTATCCCCCGACCCCGAGACATTCGCCCAGAACAGAGAACTCGAAGTCATC CACTGCAGGTGGGCCATGCTCGGAGCTCTTGGCTGTCGTCTTCCCGGAGCTGCTGTCCAGGAACGGAGTTAA
AA sequence Show only first row Show all	>Lus10023321 pacid=23181056 polypeptide=Lus10023321 locus=Lus10023321.g ID=Lus10023321.BGIv1.0 annot-version=v1.0 MAASTMALSSSTFAGKSAGLSPKSVSGGSRIMMRKTSAKAKQVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTPGLSPDPETFAQNRELEVI HCRWAMLGALGCRLPGAAVQERS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29910		AB180, LHCB1.2,...	LIGHT HARVESTING CHLOROPHYLL A...		Lus10023321 [exp]	0	1
AT3G59400		GUN4	GENOMES UNCOUPLED 4, enzyme bi...		Lus10033819 [exp]	1.4	0.9397
AT5G54270		LHCB3*1, LHCB3*...	light-harvesting chlorophyll B...		Lus10038575 [exp]	2.0	0.9435
AT5G17870		PSRP6	plastid-specific 50S ribosomal...		Lus10007237 [exp]	3.0	0.9226
AT1G29930		LHCB1.3, CAB140...	LIGHT-HARVESTING CHLOROPHYLL A...		Lus10008594 [exp]	5.3	0.9188
AT2G23670		YCF37	homolog of Synechocystis YCF37...		Lus10022478 [exp]	6.3	0.9108
AT3G20680			Domain of unknown function (DU...		Lus10006344 [exp]	8.9	0.8689
AT1G29910		AB180, LHCB1.2,...	LIGHT HARVESTING CHLOROPHYLL A...		Lus10038490 [exp]	9.5	0.8799
AT4G10340		LHCB5	light harvesting complex of ph...		Lus10039156 [exp]	9.8	0.8962
AT4G10340		LHCB5	light harvesting complex of ph...		Lus10013778 [exp]	10.0	0.8936
AT3G56940		CRD1, CHL27, AC...	COPPER RESPONSE DEFECT 1, dica...		Lus10035398 [exp]	13.2	0.9029

Compare expression of checked genes

Lus10023321 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.