Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59700 47 / 2e-07 Protein kinase superfamily protein (.1) AT3G46290 46 / 2e-07 HERK1 hercules receptor kinase 1 (.1) AT5G38990 45 / 4e-07 Malectin/receptor-like protein kinase family protein (.1) AT5G39020 39 / 8e-05 Malectin/receptor-like protein kinase family protein (.1) AT5G39000 39 / 0.0001 Malectin/receptor-like protein kinase family protein (.1) AT4G39110 39 / 0.0001 Malectin/receptor-like protein kinase family protein (.1) AT5G39030 39 / 0.0001 Protein kinase superfamily protein (.1) AT5G54380 39 / 0.0001 THE1 THESEUS1, protein kinase family protein (.1) AT1G30570 37 / 0.0003 HERK2 hercules receptor kinase 2 (.1) AT5G24010 37 / 0.0006 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038487 [exp] 114 / 2e-31 AT5G59700 293 / 1e-90 Protein kinase superfamily protein (.1) Lus10042844 [exp] 69 / 3e-15 AT3G46290 1025 / 0.0 hercules receptor kinase 1 (.1) Lus10028140 [exp] 68 / 8e-15 AT3G46290 1024 / 0.0 hercules receptor kinase 1 (.1) Lus10029945 [exp] 38 / 0.0002 AT3G51550 424 / 1e-137 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Lus10012101 [exp] 37 / 0.0006 AT2G23200 494 / 2e-162 Protein kinase superfamily protein (.1) Lus10003312 [exp] 37 / 0.0008 AT3G46290 741 / 0.0 hercules receptor kinase 1 (.1) Lus10030308 [exp] 36 / 0.001 AT3G46290 735 / 0.0 hercules receptor kinase 1 (.1) Lus10037887 [exp] 36 / 0.001 AT5G54380 1279 / 0.0 THESEUS1, protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G026600 [exp] 59 / 1e-11 AT3G46290 1093 / 0.0 hercules receptor kinase 1 (.1) Potri.001G234200 [exp] 54 / 6e-10 AT3G46290 1106 / 0.0 hercules receptor kinase 1 (.1) Potri.004G158700 [exp] 47 / 2e-07 AT4G39110 1199 / 0.0 Malectin/receptor-like protein kinase family protein (.1) Potri.009G120400 [exp] 47 / 2e-07 AT4G39110 1210 / 0.0 Malectin/receptor-like protein kinase family protein (.1) Potri.017G096800 [exp] 45 / 7e-07 AT3G51550 823 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.017G096000 [exp] 45 / 7e-07 AT3G51550 832 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.017G096600 [exp] 44 / 2e-06 AT3G51550 829 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.017G095900 [exp] 43 / 4e-06 AT3G51550 845 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.010G213200 [exp] 42 / 1e-05 AT3G46290 808 / 0.0 hercules receptor kinase 1 (.1) Potri.001G405500 [exp] 39 / 6e-05 AT5G54380 1232 / 0.0 THESEUS1, protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023324 pacid=23180913 polypeptide=Lus10023324 locus=Lus10023324.g ID=Lus10023324.BGIv1.0 annot-version=v1.0 ATGTTCCAAGCCAGCTTCGACGTCTCCACCGGGAAGCAGAGCCTTCTCAGCAACTTCAGTGTCGATGGTACTTTCAGTACCACGCTAGTACTCGAGGAGT TCTCGTTGAACCTGGCATCTTCGAGTAGCCTCGCGATCACCTTCGTGCCTTCCCCGAATTCGTTCGCGTATGTCAACGCGTTGGAAGTGGTTTCGGTCCC CGATTACCTGATCAAAGAAGGTACTGTTGAGATCGATGTGTAA
AA sequence Show only first row Show all	>Lus10023324 pacid=23180913 polypeptide=Lus10023324 locus=Lus10023324.g ID=Lus10023324.BGIv1.0 annot-version=v1.0 MFQASFDVSTGKQSLLSNFSVDGTFSTTLVLEEFSLNLASSSSLAITFVPSPNSFAYVNALEVVSVPDYLIKEGTVEIDV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59700			Protein kinase superfamily pro...		Lus10023324 [exp]	0	1
AT2G39530			Uncharacterised protein family...		Lus10031305 [exp]	2.0	0.9062
					Lus10000914 [exp]	2.8	0.9062
AT3G04290		ATLTL1, LTL1	Li-tolerant lipase 1 (.1)		Lus10036966 [exp]	3.5	0.8989
AT4G25350		SHB1	SHORT HYPOCOTYL UNDER BLUE1, E...		Lus10037146 [exp]	4.0	0.8909
AT4G20780		CML42	calmodulin like 42 (.1)		Lus10035611 [exp]	8.1	0.6992
					Lus10020633 [exp]	8.8	0.6843
AT4G01575			serine protease inhibitor, Kaz...		Lus10010094 [exp]	13.6	0.7793
AT5G44150			unknown protein		Lus10014193 [exp]	13.7	0.6273
AT3G22040			Domain of unknown function (DU...		Lus10007506 [exp]	14.1	0.6352
AT3G54340	MADS	AP3, ATAP3	APETALA 3, K-box region and MA...		Lus10041807 [exp]	15.5	0.6792

Compare expression of checked genes

Lus10023324 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.