Lus10023330 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G14080 55 / 1e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G18350 52 / 8e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT3G44630 51 / 2e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3)
AT5G49140 51 / 2e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT3G44480 50 / 3e-07 COG1, RPP10, RPP1 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT1G69550 48 / 2e-06 disease resistance protein (TIR-NBS-LRR class) (.1)
AT4G19050 47 / 3e-06 NB-ARC domain-containing disease resistance protein (.1)
AT3G15410 47 / 3e-06 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2)
AT4G16890 46 / 9e-06 BAL, SNC1 SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1, BALL, disease resistance protein (TIR-NBS-LRR class), putative (.1)
AT2G25790 46 / 1e-05 Leucine-rich receptor-like protein kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038482 312 / 3e-99 AT1G69550 386 / 3e-113 disease resistance protein (TIR-NBS-LRR class) (.1)
Lus10023272 179 / 1e-51 AT5G36930 423 / 4e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10000945 147 / 7e-41 AT1G69550 112 / 3e-25 disease resistance protein (TIR-NBS-LRR class) (.1)
Lus10038533 143 / 3e-39 AT1G27170 386 / 7e-114 transmembrane receptors;ATP binding (.1.2)
Lus10020534 137 / 6e-37 AT5G36930 414 / 1e-124 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10020533 133 / 1e-35 AT1G27170 405 / 1e-122 transmembrane receptors;ATP binding (.1.2)
Lus10004911 133 / 1e-35 AT1G27170 387 / 5e-115 transmembrane receptors;ATP binding (.1.2)
Lus10023487 132 / 3e-35 AT5G36930 284 / 4e-78 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10004115 130 / 9e-35 AT5G27970 689 / 0.0 ARM repeat superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G068200 70 / 9e-14 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.T005501 61 / 8e-11 AT5G36930 612 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.006G282300 52 / 6e-08 AT5G36930 413 / 3e-125 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G003285 51 / 2e-07 AT5G36930 640 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.011G009400 51 / 2e-07 AT5G36930 504 / 4e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.017G104301 50 / 5e-07 AT5G17680 566 / 1e-178 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.002G258200 50 / 5e-07 AT4G08850 674 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1.2)
Potri.002G258000 49 / 8e-07 AT4G08850 695 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1.2)
Potri.007G016700 49 / 1e-06 AT5G46330 286 / 5e-84 FLAGELLIN-SENSITIVE 2, Leucine-rich receptor-like protein kinase family protein (.1)
Potri.013G097832 49 / 1e-06 AT4G12010 148 / 8e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1)
PFAM info
Representative CDS sequence
>Lus10023330 pacid=23180973 polypeptide=Lus10023330 locus=Lus10023330.g ID=Lus10023330.BGIv1.0 annot-version=v1.0
ATGAGAGGTGAAGATTTTGAGCTGACAGACACTGAATTCAAGAAATTATCTGGCTTAGAATATCTAGATGTGAGGAATGGAAGAGTAACTGGAGATTTTA
AAGACATTCTTCCACATGTTTCACCCAAGCTTAAAGTTGTGGATGTATGGTCTTGTAAGGATTTAGAGACGGCTCCCAACTTGTCTCAGTGTCAAAGTGT
AGAGCGTTTAAAACTCCAGGACTGTCAGAAGATGAGAGGGGAACTGCATATTGGTAATTTTAAGAAACTAAAAGTGCTGAAGCTCGGGTATACTAAAATA
ACGAAGTTAACAGGCGGCATGGGAGTTCTTAAGAATCTCCAGGAGATTGATGCAGGGAACTCCTATTTGACAGAAGTGCCTTCTGGTATTGCCGAATTAT
CCTCTCTTAAAACCTTGGATCTAAGGTCGCATAAACTGGGATTGAAGGAATTACCAACACTCCCTAAAAGTTTAAAGCGCCTATATCTCTCATCGCCATG
GGTGCCTAACCTTTTGGCGCTCAAGGACTTGAAAGAGCTAGGGTTTTCAAATTGTGAAGCTCCTGAAATTCCAGGGGATGTATGGATGCTATCCAAGTTG
AAGTCTTTGAGTCTGTCGGACTGCACCTGTGAAAGTCTCTAG
AA sequence
>Lus10023330 pacid=23180973 polypeptide=Lus10023330 locus=Lus10023330.g ID=Lus10023330.BGIv1.0 annot-version=v1.0
MRGEDFELTDTEFKKLSGLEYLDVRNGRVTGDFKDILPHVSPKLKVVDVWSCKDLETAPNLSQCQSVERLKLQDCQKMRGELHIGNFKKLKVLKLGYTKI
TKLTGGMGVLKNLQEIDAGNSYLTEVPSGIAELSSLKTLDLRSHKLGLKELPTLPKSLKRLYLSSPWVPNLLALKDLKELGFSNCEAPEIPGDVWMLSKL
KSLSLSDCTCESL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G14080 Disease resistance protein (TI... Lus10023330 0 1
AT5G36930 Disease resistance protein (TI... Lus10023329 1.0 0.9385
AT4G21870 HSP20-like chaperones superfam... Lus10007666 2.0 0.8371
AT5G55710 AtTic20-V translocon at the inner envelo... Lus10031203 4.2 0.8146
Lus10007688 6.2 0.7325
Lus10027443 8.8 0.7712
AT1G74250 DNAJ heat shock N-terminal dom... Lus10012524 9.6 0.8023
Lus10038412 9.8 0.7596
AT4G02340 alpha/beta-Hydrolases superfam... Lus10037559 10.7 0.7767
AT3G20810 JMJ30, JMJD5 2-oxoglutarate (2OG) and Fe(II... Lus10031247 18.7 0.7313
AT1G61680 ATTPS14 terpene synthase 14 (.1.2) Lus10035240 21.5 0.6948

Lus10023330 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.