Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23130 187 / 2e-56 RLK6, CRK5 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2) AT4G11530 186 / 1e-55 CRK34 cysteine-rich RLK (RECEPTOR-like protein kinase) 34 (.1) AT4G23310 186 / 3e-55 CRK23 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) AT4G23180 185 / 3e-55 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT4G23140 184 / 5e-55 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) AT4G38830 183 / 9e-55 CRK26 cysteine-rich RLK (RECEPTOR-like protein kinase) 26 (.1) AT4G23220 183 / 2e-54 CRK14 cysteine-rich RLK (RECEPTOR-like protein kinase) 14 (.1) AT4G23270 182 / 2e-54 CRK19 cysteine-rich RLK (RECEPTOR-like protein kinase) 19 (.1) AT3G45860 181 / 6e-54 CRK4 cysteine-rich RLK (RECEPTOR-like protein kinase) 4 (.1) AT1G61430 182 / 7e-54 S-locus lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027146 [exp] 298 / 1e-98 AT4G23180 451 / 1e-150 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10031579 [exp] 191 / 2e-57 AT4G23160 477 / 8e-154 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) Lus10015091 [exp] 191 / 3e-56 AT5G54650 556 / 1e-178 FORMIN HOMOLOGY 5, formin homology5 (.1.2) Lus10031578 [exp] 186 / 8e-56 AT4G23180 422 / 5e-134 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10006745 [exp] 187 / 9e-56 AT1G11340 774 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10015092 [exp] 185 / 1e-55 AT4G23180 397 / 1e-130 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10015094 [exp] 185 / 3e-55 AT4G23160 432 / 7e-143 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) Lus10020083 [exp] 179 / 3e-55 AT4G21390 427 / 6e-143 S-locus lectin protein kinase family protein (.1) Lus10037732 [exp] 185 / 1e-54 AT4G21380 768 / 0.0 receptor kinase 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G120900 [exp] 218 / 9e-68 AT4G23180 454 / 3e-151 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.011G035850 [exp] 189 / 3e-59 AT4G23270 397 / 6e-134 cysteine-rich RLK (RECEPTOR-like protein kinase) 19 (.1) Potri.019G119851 [exp] 183 / 2e-58 AT4G03230 325 / 1e-104 S-locus lectin protein kinase family protein (.1) Potri.011G125201 [exp] 183 / 2e-58 AT4G27300 328 / 1e-107 S-locus lectin protein kinase family protein (.1) Potri.004G027800 [exp] 194 / 6e-58 AT4G21390 941 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G125100 [exp] 193 / 1e-57 AT4G27290 856 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028701 [exp] 193 / 2e-57 AT1G11340 899 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028600 [exp] 192 / 4e-57 AT1G11340 875 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G120000 [exp] 192 / 6e-57 AT4G03230 967 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G024632 [exp] 182 / 1e-56 AT4G23180 527 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10023335 pacid=23180909 polypeptide=Lus10023335 locus=Lus10023335.g ID=Lus10023335.BGIv1.0 annot-version=v1.0 ATGCAGTACCTGCATGAAGATTCACGGCTTAATATAATTCACCGCAATTTGAAAGGAGGGAACATCCTGTTAGACGAGTCTATGAACCCCAAAATTTCTG ATTTCGGGACTGCAAGACTCTTCTCTGGAACTGGGTCTCACATCAAAACAAGAAGGGTTACTGGGACTCGTGGCCACACAGCCCCAGAGTATGTCAACAA TGGTGTCTTCTCTACGAAATCTGATGTCTATAGCTTTGGAATTCTGATCTTGGAGATCATTAGTGGTGATAATATCTCTAGTGCCCGAAATTACTCCAAT CTGCAGAGTGATGCGTGGGAACTTTGGATGAAAGGTAAAGCCCTGGACTTTCTTGATCGAACCTTGAGTGGCAAGCATTCGGTACATGAAGCTATGAAGT GCATCCAAGTTGGGTTGTTATGTGTCCAGAAAGTTTCTGCAGAGAGGCCTACAATGTCATCCATTGTTCTGATGCTTAACAATAACACGTCAACACCATC GAAGCCAGGATTTTTCTTTACAAGGATACTTGTTAACGGGCCTCGTTGA
AA sequence Show only first row Show all	>Lus10023335 pacid=23180909 polypeptide=Lus10023335 locus=Lus10023335.g ID=Lus10023335.BGIv1.0 annot-version=v1.0 MQYLHEDSRLNIIHRNLKGGNILLDESMNPKISDFGTARLFSGTGSHIKTRRVTGTRGHTAPEYVNNGVFSTKSDVYSFGILILEIISGDNISSARNYSN LQSDAWELWMKGKALDFLDRTLSGKHSVHEAMKCIQVGLLCVQKVSAERPTMSSIVLMLNNNTSTPSKPGFFFTRILVNGPR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G23310		CRK23	cysteine-rich RLK (RECEPTOR-li...		Lus10023335 [exp]	0	1
					Lus10034979 [exp]	1.0	0.9628
AT3G60160		ATMRP9, ABCC9	ATP-binding cassette C9, multi...		Lus10022808 [exp]	2.8	0.9229
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10021233 [exp]	2.8	0.9518
AT5G46090			Protein of unknown function (D...		Lus10013933 [exp]	3.2	0.9372
AT2G38080		ATLMCO4, IRX12,...	LACCASE 4, IRREGULAR XYLEM 12,...		Lus10040226 [exp]	3.9	0.9479
AT5G65165		SDH2-3	succinate dehydrogenase 2-3 (....		Lus10028289 [exp]	5.5	0.9285
AT5G01930		MAN6, AtMAN6	endo-beta-mannase 6, Glycosyl ...		Lus10022729 [exp]	5.7	0.9405
AT4G28380			Leucine-rich repeat (LRR) fami...		Lus10017713 [exp]	6.7	0.9220
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Lus10026625 [exp]	8.2	0.8824
AT3G49210			O-acyltransferase (WSD1-like) ...		Lus10033680 [exp]	8.4	0.9202

Compare expression of checked genes

Lus10023335 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.