Lus10023337 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52300 269 / 9e-94 ATPQ "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038474 309 / 2e-109 AT3G52300 297 / 7e-105 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Lus10023492 286 / 3e-100 AT3G52300 295 / 8e-104 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Lus10040374 285 / 5e-100 AT3G52300 293 / 3e-103 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G043800 281 / 2e-98 AT3G52300 291 / 3e-102 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Potri.010G217800 274 / 1e-95 AT3G52300 281 / 1e-98 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05873 Mt_ATP-synt_D ATP synthase D chain, mitochondrial (ATP5H)
Representative CDS sequence
>Lus10023337 pacid=23180977 polypeptide=Lus10023337 locus=Lus10023337.g ID=Lus10023337.BGIv1.0 annot-version=v1.0
ATGAGCGGAGCTGCGAAGAAGGTTACCGATGTGGCGTTCAAGGCTTCAAAGAACATCGATTGGGAAGGCATGGCCAAGCTCATAGTCTCCGACGAGGCTC
GCAAGGAATTCGCCAATCTCCGCCGCGCCTTCGACGAAGTTAACTCCCAACTCCAGACCAAGTTTAGCCAGGAACCCGAACCCATAGACTGGGAATATTA
CCGAAAGGGGATTGGCCCACGCTTGGTTGATATGTACAAGGAAGCATATGACAGCATTGAGATACCCAAGTATGAAGACAAAGTCACCCCAGAGTACAAA
CCAAAGTTTGATCAACTGATGGTGGAATTGAAAGAAGCAGAGCAAAAGTCGCTGAAAGAATCCGAAAGATTGGAGAAGGAAGTTGCTGAAGTGCAAGAGT
TAAAGAAAAAGATCAGCACAATGACAGCCGATGAGTACTTTGAGAAGCACCCTGAGCTTAAGAAGAAGTTCGACGACGAAATCCGCAATGACTACTGGGG
TTACTGA
AA sequence
>Lus10023337 pacid=23180977 polypeptide=Lus10023337 locus=Lus10023337.g ID=Lus10023337.BGIv1.0 annot-version=v1.0
MSGAAKKVTDVAFKASKNIDWEGMAKLIVSDEARKEFANLRRAFDEVNSQLQTKFSQEPEPIDWEYYRKGIGPRLVDMYKEAYDSIEIPKYEDKVTPEYK
PKFDQLMVELKEAEQKSLKESERLEKEVAEVQELKKKISTMTADEYFEKHPELKKKFDDEIRNDYWGY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Lus10023337 0 1
AT3G05545 RING/U-box superfamily protein... Lus10029886 2.8 0.8174
AT1G08480 SDH6 succinate dehydrogenase 6, unk... Lus10008448 3.0 0.8776
AT5G64080 AtXYP1 xylogen protein 1, Bifunctiona... Lus10021604 3.9 0.8469
AT5G14230 unknown protein Lus10022339 5.0 0.7996
AT3G63170 Chalcone-flavanone isomerase f... Lus10022045 5.2 0.7891
AT1G12310 Calcium-binding EF-hand family... Lus10004332 5.5 0.8499
AT2G02050 NADH-ubiquinone oxidoreductase... Lus10035094 7.3 0.7927
AT5G23290 PFD5, PDF5 prefoldin 5 (.1) Lus10010176 11.2 0.7695
AT2G02050 NADH-ubiquinone oxidoreductase... Lus10034424 12.0 0.7776
AT5G65430 14-3-3KAPPA, GF... 14-3-3 PROTEIN G-BOX FACTOR14 ... Lus10040534 12.4 0.7758

Lus10023337 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.