Lus10023352 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10023352 pacid=23180935 polypeptide=Lus10023352 locus=Lus10023352.g ID=Lus10023352.BGIv1.0 annot-version=v1.0
ATGATTCTCCAGGATTTGTTTGATTTTGACTTGTCAAGGGTGATTCTTTTGCTCCACCTTCATAGCTCCGTCGACCAACGATCCCGATCAAGGAGTTTCT
CGCTTCCCATGATATCTCGAGCTCCACCTTCGAAGCTCTCCGGTCCGAGTCCGCCTTTAGCACTGGAAATTGATGGTTTTGAGGAAGTCTTGCTGAACCT
GTGA
AA sequence
>Lus10023352 pacid=23180935 polypeptide=Lus10023352 locus=Lus10023352.g ID=Lus10023352.BGIv1.0 annot-version=v1.0
MILQDLFDFDLSRVILLLHLHSSVDQRSRSRSFSLPMISRAPPSKLSGPSPPLALEIDGFEEVLLNL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10023352 0 1
AT1G47550 SEC3A exocyst complex component sec3... Lus10001022 2.0 1.0000
Lus10028048 3.0 1.0000
AT5G67440 MEL2, NPY3 NAKED PINS IN YUC MUTANTS 3, M... Lus10025193 3.2 1.0000
AT4G14130 XTR7, XTH15 xyloglucan endotransglycosylas... Lus10008888 4.5 1.0000
Lus10009177 5.0 1.0000
Lus10035026 5.5 1.0000
AT2G25270 unknown protein Lus10014341 6.9 0.8789
Lus10001123 9.0 1.0000
AT1G54130 AT-RSH3, RSH3, ... RELA/SPOT homolog 3 (.1) Lus10011252 9.2 1.0000
AT5G49330 MYB PFG3, ATMYB111 PRODUCTION OF FLAVONOL GLYCOSI... Lus10000008 9.8 1.0000

Lus10023352 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.