Lus10023356 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G29130 162 / 9e-53 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000252 262 / 4e-92 AT3G29130 162 / 9e-53 unknown protein
Lus10038450 249 / 5e-87 AT3G29130 165 / 7e-54 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G098200 176 / 3e-58 AT3G29130 142 / 4e-45 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10241 KxDL Uncharacterized conserved protein
Representative CDS sequence
>Lus10023356 pacid=23180991 polypeptide=Lus10023356 locus=Lus10023356.g ID=Lus10023356.BGIv1.0 annot-version=v1.0
ATGGAGCGAACTGAGGAGAAGGAATCCATAGCAGATGCTTCCAAGGAGATTTCTCGAGAATTCAAAACCCTGATCGACGGCGAAGAATTGGATACCCTCA
AGCAATCCCAGCATCTCATATTGGGAAGGTGGCAGGACAGCAATGCAGTCCTGTCTCATTTTAACGATTACTCGGAAAACTGCTTCACGGAGGTTTCCGG
TGATTTTTACAAGAACACTCGACTGCTGAAGTCTATGAAGGCTGATCTTGATTACATATTTTTGAAGCTTAGAACTATGAAATCTAAAATCTCAGCTGTT
TATCCTGATGCATTTACAGACGAATCAGGGAAACAAGTAGAGGATAGAAGACCGAACCTTGAAGCACCTATGGAACCCTAG
AA sequence
>Lus10023356 pacid=23180991 polypeptide=Lus10023356 locus=Lus10023356.g ID=Lus10023356.BGIv1.0 annot-version=v1.0
MERTEEKESIADASKEISREFKTLIDGEELDTLKQSQHLILGRWQDSNAVLSHFNDYSENCFTEVSGDFYKNTRLLKSMKADLDYIFLKLRTMKSKISAV
YPDAFTDESGKQVEDRRPNLEAPMEP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G29130 unknown protein Lus10023356 0 1
AT4G01790 Ribosomal protein L7Ae/L30e/S1... Lus10007191 1.0 0.8829
AT1G60430 ARPC3 actin-related protein C3 (.1.2... Lus10018909 4.0 0.8441
AT1G67710 GARP ARR11 response regulator 11 (.1) Lus10011389 8.8 0.8101
AT5G59610 Chaperone DnaJ-domain superfam... Lus10016510 9.6 0.8265
AT5G11900 Translation initiation factor ... Lus10024986 10.9 0.8152
AT2G36410 Family of unknown function (DU... Lus10023876 11.0 0.8152
AT5G46030 unknown protein Lus10015293 11.7 0.8285
AT5G66200 ARO2 armadillo repeat only 2 (.1) Lus10036897 13.2 0.7892
AT4G29070 Phospholipase A2 family protei... Lus10035314 14.9 0.8041
AT2G39435 Phosphatidylinositol N-acetygl... Lus10030320 15.8 0.8258

Lus10023356 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.