Lus10023364 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07820 111 / 5e-30 Pectin lyase-like superfamily protein (.1)
AT3G14040 110 / 2e-29 Pectin lyase-like superfamily protein (.1)
AT3G07850 107 / 3e-28 Pectin lyase-like superfamily protein (.1)
AT3G07830 106 / 5e-28 Pectin lyase-like superfamily protein (.1)
AT4G18180 106 / 6e-28 Pectin lyase-like superfamily protein (.1)
AT5G48140 105 / 7e-28 Pectin lyase-like superfamily protein (.1)
AT3G07840 103 / 4e-27 Pectin lyase-like superfamily protein (.1)
AT2G43880 101 / 4e-26 Pectin lyase-like superfamily protein (.1)
AT2G43870 101 / 4e-26 Pectin lyase-like superfamily protein (.1)
AT3G59850 96 / 3e-24 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039154 124 / 9e-35 AT5G48140 335 / 8e-113 Pectin lyase-like superfamily protein (.1)
Lus10013784 122 / 9e-34 AT5G48140 337 / 2e-113 Pectin lyase-like superfamily protein (.1)
Lus10013780 122 / 9e-34 AT5G48140 337 / 2e-113 Pectin lyase-like superfamily protein (.1)
Lus10003001 122 / 5e-33 AT3G07840 362 / 1e-118 Pectin lyase-like superfamily protein (.1)
Lus10041059 120 / 5e-33 AT3G07830 310 / 1e-102 Pectin lyase-like superfamily protein (.1)
Lus10041058 120 / 6e-33 AT3G07830 311 / 1e-102 Pectin lyase-like superfamily protein (.1)
Lus10009606 116 / 1e-31 AT3G07840 323 / 4e-108 Pectin lyase-like superfamily protein (.1)
Lus10043088 115 / 2e-31 AT3G07820 360 / 6e-123 Pectin lyase-like superfamily protein (.1)
Lus10038316 107 / 6e-31 AT3G14040 92 / 3e-23 Pectin lyase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G067166 134 / 1e-38 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1)
Potri.019G067200 134 / 1e-38 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1)
Potri.019G067133 134 / 1e-38 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1)
Potri.019G067100 133 / 4e-38 AT3G07820 404 / 5e-140 Pectin lyase-like superfamily protein (.1)
Potri.019G066800 130 / 3e-37 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1)
Potri.019G067000 130 / 3e-37 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1)
Potri.019G067050 130 / 3e-37 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1)
Potri.007G035800 126 / 1e-35 AT3G07820 350 / 7e-119 Pectin lyase-like superfamily protein (.1)
Potri.014G162300 106 / 2e-28 AT3G07850 358 / 3e-122 Pectin lyase-like superfamily protein (.1)
Potri.010G007300 105 / 1e-27 AT4G18180 289 / 2e-94 Pectin lyase-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence
>Lus10023364 pacid=23181082 polypeptide=Lus10023364 locus=Lus10023364.g ID=Lus10023364.BGIv1.0 annot-version=v1.0
ATGGTAACAAACCTGACTTGTGGGCCCGGACACGGTACCAGCATTGGAAGTTTGGGAAAGTATCCCGACGAGAAGTGTGTCAAGAATGTCATTGTCAAAA
ACGGCACTTTGACAGATACTGATAACGTCGGTGTCAGTATCAAGTTGTGGCCAAATCTGTTCCCAGGAGAAGCATCTGACGTACATTTCAAAGATATCAT
AATGAACAAAGTGAATAACCCGATAATCATCGATCAGACTTGCTGCCCGGGGCATACATGCGGTGCGAACAGGATCGCTTCAAAGGTTAAGATCAACAAC
GTGGTGTTCAAGAACATCAAGGGGACTTCCAAGAATCCAGATGGCGAATTCATGGCGGAATTCATGACCACAGATGGATTCACAACGATGAAGATTGTGA
TTATCGGAGGTTCGTCGTAG
AA sequence
>Lus10023364 pacid=23181082 polypeptide=Lus10023364 locus=Lus10023364.g ID=Lus10023364.BGIv1.0 annot-version=v1.0
MVTNLTCGPGHGTSIGSLGKYPDEKCVKNVIVKNGTLTDTDNVGVSIKLWPNLFPGEASDVHFKDIIMNKVNNPIIIDQTCCPGHTCGANRIASKVKINN
VVFKNIKGTSKNPDGEFMAEFMTTDGFTTMKIVIIGGSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G14040 Pectin lyase-like superfamily ... Lus10023364 0 1
AT3G16180 Major facilitator superfamily ... Lus10009506 1.7 1.0000
Lus10033149 2.4 1.0000
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10023215 3.0 1.0000
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10003281 4.5 1.0000
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10027028 5.3 1.0000
AT1G29430 SAUR-like auxin-responsive pro... Lus10020441 5.7 1.0000
AT1G75660 AtXRN3, XRN3 5'-3' exoribonuclease 3 (.1) Lus10005213 6.0 0.9900
AT3G24140 bHLH bHLH097, FMA FAMA, basic helix-loop-helix (... Lus10007138 6.3 0.9823
AT1G21880 LYM1 lysm domain GPI-anchored prote... Lus10006200 6.5 1.0000
AT4G30030 Eukaryotic aspartyl protease f... Lus10011612 6.5 0.9333

Lus10023364 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.