Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G30690 129 / 1e-36 Sec14p-like phosphatidylinositol transfer family protein (.1.2) AT1G72150 92 / 3e-23 PATL1 PATELLIN 1 (.1) AT1G22530 92 / 4e-23 PATL2 PATELLIN 2 (.1) AT3G51670 86 / 5e-21 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein (.1) AT1G72160 83 / 5e-20 Sec14p-like phosphatidylinositol transfer family protein (.1) AT4G09160 81 / 4e-19 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038435 [exp] 202 / 3e-64 AT1G30690 513 / 2e-178 Sec14p-like phosphatidylinositol transfer family protein (.1.2) Lus10031175 [exp] 122 / 8e-36 AT1G30690 273 / 2e-89 Sec14p-like phosphatidylinositol transfer family protein (.1.2) Lus10031752 [exp] 120 / 5e-33 AT1G30690 412 / 4e-137 Sec14p-like phosphatidylinositol transfer family protein (.1.2) Lus10001269 [exp] 96 / 1e-24 AT3G51670 602 / 0.0 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein (.1) Lus10001542 [exp] 96 / 2e-24 AT1G72160 450 / 8e-155 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10009453 [exp] 94 / 3e-24 AT1G72160 389 / 9e-134 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10012219 [exp] 94 / 6e-24 AT3G51670 564 / 0.0 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein (.1) Lus10003552 [exp] 93 / 3e-23 AT1G30690 290 / 4e-92 Sec14p-like phosphatidylinositol transfer family protein (.1.2) Lus10001539 [exp] 79 / 7e-19 AT1G72160 490 / 1e-173 Sec14p-like phosphatidylinositol transfer family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G461400 [exp] 145 / 1e-42 AT1G30690 497 / 4e-172 Sec14p-like phosphatidylinositol transfer family protein (.1.2) Potri.016G127700 [exp] 97 / 3e-25 AT3G51670 641 / 0.0 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein (.1) Potri.005G224800 [exp] 96 / 2e-24 AT1G30690 333 / 4e-109 Sec14p-like phosphatidylinositol transfer family protein (.1.2) Potri.013G106000 [exp] 83 / 5e-20 AT1G72160 457 / 6e-156 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.019G079500 [exp] 83 / 6e-20 AT1G72160 439 / 1e-148 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.013G105900 [exp] 82 / 2e-19 AT1G72160 574 / 0.0 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.019G079300 [exp] 80 / 7e-19 AT1G72160 545 / 0.0 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.004G138200 [exp] 79 / 2e-18 AT1G72160 457 / 2e-156 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.T011100 [exp] 77 / 6e-18 AT1G72160 454 / 6e-155 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.T011101 [exp] 76 / 2e-17 AT1G72160 452 / 4e-154 Sec14p-like phosphatidylinositol transfer family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023377 pacid=23181028 polypeptide=Lus10023377 locus=Lus10023377.g ID=Lus10023377.BGIv1.0 annot-version=v1.0 ATGGAGGCTTTCGTGAAAGCCGGGTCAACGGAGAGCATAGAGATTCCGGCGACAGAGGTGGGCGGTGGCACATTGCTGTGGGACGTGACGGTGGTGGGAT GGGAAGTGAGGTACAAGGAAGAGTTCGTTCCAGCTGATGCAGGGTCGTACACCATTATCATTCAACAGGAGAGGAAGATCGGTGCTGGGGAAGAGGCGAT TCGGAACAGTTACACGAACGGTGAGGCCGGGAAAGTGGTGGTAACGGTGGAGAACTGTTCAAGCAAGAAGAAGAGGGTTCTTTACAGGTACAAGACCCAG AAGAGTGCTTAA
AA sequence Show only first row Show all	>Lus10023377 pacid=23181028 polypeptide=Lus10023377 locus=Lus10023377.g ID=Lus10023377.BGIv1.0 annot-version=v1.0 MEAFVKAGSTESIEIPATEVGGGTLLWDVTVVGWEVRYKEEFVPADAGSYTIIIQQERKIGAGEEAIRNSYTNGEAGKVVVTVENCSSKKKRVLYRYKTQ KSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G30690			Sec14p-like phosphatidylinosit...		Lus10023377 [exp]	0	1
AT1G30690			Sec14p-like phosphatidylinosit...		Lus10038435 [exp]	14.5	0.7961
AT4G12730		FLA2	FASCICLIN-like arabinogalactan...		Lus10012344 [exp]	18.5	0.7764
AT3G18950			Transducin/WD40 repeat-like su...		Lus10021014 [exp]	24.7	0.7304
AT5G40150			Peroxidase superfamily protein...		Lus10039445 [exp]	27.7	0.7736
AT4G12730		FLA2	FASCICLIN-like arabinogalactan...		Lus10006391 [exp]	33.7	0.7614
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Lus10005767 [exp]	36.8	0.7408
AT5G47520		AtRABA5a	RAB GTPase homolog A5A (.1)		Lus10000536 [exp]	38.3	0.7395
AT5G25830	GATA	GATA12	GATA transcription factor 12 (...		Lus10002036 [exp]	38.3	0.7462
AT4G18540			unknown protein		Lus10036093 [exp]	42.4	0.6249
AT1G18210			Calcium-binding EF-hand family...		Lus10042008 [exp]	44.5	0.6971

Compare expression of checked genes

Lus10023377 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.