Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023403 pacid=23160482 polypeptide=Lus10023403 locus=Lus10023403.g ID=Lus10023403.BGIv1.0 annot-version=v1.0 ATGGAGTTTGTTCATCTGATTCATGGAATGGGGGAGGGGGGGATTAATAAAACTAGGGTTGCAGCTAACTCACTCATAGCCCCAATGGAAGTGATGAGCT CTATAGATGCATATGCAGACTACTGGTGGGAAGAATTGATCGACTTTCGTGGCAGAAGTGGAAAAGATCAAAGCTTTTTCTTGTTTAGAGTTCAGGATGA TCATCTGTGGGCTTAA
AA sequence Show only first row Show all	>Lus10023403 pacid=23160482 polypeptide=Lus10023403 locus=Lus10023403.g ID=Lus10023403.BGIv1.0 annot-version=v1.0 MEFVHLIHGMGEGGINKTRVAANSLIAPMEVMSSIDAYADYWWEELIDFRGRSGKDQSFFLFRVQDDHLWA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10023403 [exp]	0	1
AT4G30360		ATCNGC17	cyclic nucleotide-gated channe...		Lus10023203 [exp]	2.0	0.9140
AT1G68940			Armadillo/beta-catenin-like re...		Lus10029112 [exp]	7.1	0.9195
AT2G37480			unknown protein		Lus10003982 [exp]	7.4	0.9098
AT4G27120			unknown protein		Lus10011161 [exp]	10.4	0.9130
AT1G68940			Armadillo/beta-catenin-like re...		Lus10029113 [exp]	12.0	0.9109
AT1G02170		AtMCP1b, ATMC1,...	LSD ONE LIKE 3, ARABIDOPSIS TH...		Lus10010764 [exp]	15.5	0.8920
AT5G11330			FAD/NAD(P)-binding oxidoreduct...		Lus10013122 [exp]	15.9	0.8975
AT1G14740			Protein of unknown function (D...		Lus10030769 [exp]	20.2	0.9077
AT1G54730			Major facilitator superfamily ...		Lus10029966 [exp]	21.4	0.9006
AT1G50940		ETFALPHA	electron transfer flavoprotein...		Lus10011156 [exp]	21.5	0.8925

Compare expression of checked genes

Lus10023403 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.