Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023424 pacid=23160623 polypeptide=Lus10023424 locus=Lus10023424.g ID=Lus10023424.BGIv1.0 annot-version=v1.0 ATGGTTTTCCCTTCTTCTCTTTCCGTCTACCATCTAGATCCTTCCAATTGGCAACAGAACCTGAATCCAAATGGAATAATCGGCGGTGGCGGCAGTAGTG TTGCTACCAATCAGCTCGCTCAGCCGCAGATATTGGACCCGCGGCGGCGCCCTCCGCAACGTCCCCGTCGGCGGAGGGTGCAGGCGGAACAAAAGGACCA AAGGAGGAGGGATCAGATCCAAATCAGTCGGTGGTGGGCCCAGGCCGGTTAA
AA sequence Show only first row Show all	>Lus10023424 pacid=23160623 polypeptide=Lus10023424 locus=Lus10023424.g ID=Lus10023424.BGIv1.0 annot-version=v1.0 MVFPSSLSVYHLDPSNWQQNLNPNGIIGGGGSSVATNQLAQPQILDPRRRPPQRPRRRRVQAEQKDQRRRDQIQISRWWAQAG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10023424 [exp]	0	1
AT3G49760	bZIP	ATBZIP5	basic leucine-zipper 5 (.1)		Lus10018662 [exp]	1.4	0.8765
AT3G55370	DOF	OBP3, AtDof3. 6	OBF-binding protein 3 (.1.2.3)		Lus10040305 [exp]	1.7	0.8604
AT4G29110			unknown protein		Lus10014153 [exp]	2.0	0.8943
AT1G70300		KUP6	K+ uptake permease 6, K+ uptak...		Lus10030857 [exp]	2.4	0.8310
AT5G06850			C2 calcium/lipid-binding plant...		Lus10021030 [exp]	11.2	0.8329
AT5G02750		SGR9	SHOOT GRAVITROPISM 9, RING/U-b...		Lus10003992 [exp]	11.7	0.8343
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10007421 [exp]	16.9	0.8147
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Lus10011058 [exp]	17.9	0.8286
AT3G14880			unknown protein		Lus10039193 [exp]	20.0	0.7889
AT4G21500			unknown protein		Lus10011256 [exp]	20.4	0.8116

Compare expression of checked genes

Lus10023424 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.