Lus10023429 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59850 264 / 7e-93 Ribosomal protein S8 family protein (.1)
AT1G07770 264 / 7e-93 RPS15A ribosomal protein S15A (.1.2)
AT3G46040 263 / 1e-92 RPS15AD ribosomal protein S15A D (.1)
AT2G39590 249 / 1e-86 Ribosomal protein S8 family protein (.1)
AT4G29430 148 / 5e-47 RPS15AE ribosomal protein S15A E (.1)
AT2G19720 143 / 5e-45 RPS15AB ribosomal protein S15A B (.1)
ATCG00770 40 / 6e-05 ATCG00770.1, RPS8 ribosomal protein S8 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040309 267 / 5e-94 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1)
Lus10043001 267 / 5e-94 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2)
Lus10029461 267 / 5e-94 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1)
Lus10032503 267 / 5e-94 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2)
Lus10005960 267 / 5e-94 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1)
Lus10040543 135 / 7e-42 AT4G29430 236 / 4e-82 ribosomal protein S15A E (.1)
Lus10000975 134 / 1e-41 AT4G29430 235 / 2e-81 ribosomal protein S15A E (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G208700 260 / 2e-91 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1)
Potri.001G118100 260 / 2e-91 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1)
Potri.003G114800 260 / 2e-91 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1)
Potri.008G051900 258 / 2e-90 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1)
Potri.009G071250 135 / 5e-42 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1)
Potri.009G071400 135 / 5e-42 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00410 Ribosomal_S8 Ribosomal protein S8
Representative CDS sequence
>Lus10023429 pacid=23160472 polypeptide=Lus10023429 locus=Lus10023429.g ID=Lus10023429.BGIv1.0 annot-version=v1.0
ATGGCAGCAAATATGGTGAGAATTAGCGTGCTGAACGATGCTCTCAAGAGCATGTACAATGCTGAGAAGCGCGGAAAGCGCCAGGTCATGATCAGGCCTT
CCTCGAAAGTGATCATCAAGTTCCTTATCGTCATGCAAAAGCATGGGTACATTGGCGAGTTCGAGTATGTTGATGACCACAGGGCTGGTAAAATTGTTGT
GGAGTTGAATGGAAGGCTGAACAAATGTGGTGTCATCAGTCCACGATTTGATATCGGTGTTAAGGAAATCGAGGGCTGGACTGCTAGGTTGCTTCCATCT
AGACAGTTTGGATTCATTGTCCTTACAACTTCTGCTGGAATCATGGACCATGAAGAGGCAAGGAGAAAGAATGTTGGTGGGAAAGTTCTTGGTTTCTTCT
ACTGA
AA sequence
>Lus10023429 pacid=23160472 polypeptide=Lus10023429 locus=Lus10023429.g ID=Lus10023429.BGIv1.0 annot-version=v1.0
MAANMVRISVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPS
RQFGFIVLTTSAGIMDHEEARRKNVGGKVLGFFY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G59850 Ribosomal protein S8 family pr... Lus10023429 0 1
AT1G34030 Ribosomal protein S13/S18 fami... Lus10034179 3.3 0.9283
AT2G44120 Ribosomal protein L30/L7 famil... Lus10004220 5.4 0.9499
AT4G16720 Ribosomal protein L23/L15e fam... Lus10000165 6.3 0.9316
AT2G20450 Ribosomal protein L14 (.1) Lus10011807 7.6 0.9439
AT4G18100 Ribosomal protein L32e (.1) Lus10011970 7.7 0.9407
AT4G16720 Ribosomal protein L23/L15e fam... Lus10028965 8.7 0.9403
AT4G15000 Ribosomal L27e protein family ... Lus10003814 10.4 0.9270
AT5G47630 MTACP3 mitochondrial acyl carrier pro... Lus10000050 12.1 0.8419
AT5G59850 Ribosomal protein S8 family pr... Lus10040309 13.1 0.9313
AT5G41685 Mitochondrial outer membrane t... Lus10000059 13.1 0.8663

Lus10023429 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.