Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26660 130 / 1e-39 AS2 LBD24 LOB domain-containing protein 24 (.1) AT3G26620 130 / 1e-39 AS2 LBD23 LOB domain-containing protein 23 (.1) AT2G30130 129 / 3e-38 AS2 PCK1, LBD12, ASL5 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) AT1G31320 127 / 1e-37 AS2 LBD4 LOB domain-containing protein 4 (.1) AT1G07900 125 / 1e-36 AS2 LBD1 LOB domain-containing protein 1 (.1) AT5G66870 127 / 2e-36 AS2 LBD36, ASL1 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1) AT3G27650 119 / 7e-35 AS2 LBD25 LOB domain-containing protein 25 (.1) AT2G28500 120 / 2e-34 AS2 LBD11 LOB domain-containing protein 11 (.1) AT2G23660 119 / 5e-33 AS2 LBD10 LOB domain-containing protein 10 (.1.2) AT5G63090 115 / 7e-33 AS2 LOBB, LOB Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040313 [exp] 276 / 6e-97 AT5G66870 133 / 5e-40 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1) Lus10018993 [exp] 153 / 4e-48 AT3G26660 134 / 2e-41 LOB domain-containing protein 24 (.1) Lus10033843 [exp] 147 / 1e-45 AT1G07900 143 / 8e-44 LOB domain-containing protein 1 (.1) Lus10040638 [exp] 132 / 1e-39 AT1G31320 244 / 1e-83 LOB domain-containing protein 4 (.1) Lus10018275 [exp] 130 / 4e-39 AT1G31320 243 / 2e-83 LOB domain-containing protein 4 (.1) Lus10031855 [exp] 127 / 9e-38 AT2G30130 220 / 4e-74 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10031285 [exp] 126 / 2e-37 AT2G30130 226 / 3e-76 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10007525 [exp] 125 / 8e-37 AT2G30130 204 / 1e-67 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10031191 [exp] 121 / 8e-36 AT1G31320 199 / 2e-66 LOB domain-containing protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G250700 [exp] 162 / 5e-52 AT2G30130 111 / 2e-31 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.001G081400 [exp] 134 / 2e-40 AT1G31320 228 / 3e-77 LOB domain-containing protein 4 (.1) Potri.003G149000 [exp] 132 / 5e-40 AT1G31320 241 / 2e-82 LOB domain-containing protein 4 (.1) Potri.001G281600 [exp] 130 / 5e-39 AT2G30130 248 / 4e-85 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.005G097800 [exp] 128 / 1e-38 AT1G31320 193 / 6e-64 LOB domain-containing protein 4 (.1) Potri.007G066700 [exp] 127 / 2e-38 AT1G31320 216 / 3e-73 LOB domain-containing protein 4 (.1) Potri.008G072800 [exp] 127 / 7e-38 AT2G30130 229 / 8e-78 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.009G076900 [exp] 126 / 2e-37 AT2G30130 228 / 2e-77 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.015G135900 [exp] 124 / 5e-37 AT3G26660 165 / 2e-53 LOB domain-containing protein 24 (.1) Potri.010G184400 [exp] 124 / 9e-37 AT2G30130 227 / 7e-77 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03195 [flax] [poplar] LOB Lateral organ boundaries (LOB) domain
Representative CDS sequence Show only first row Show all	>Lus10023434 pacid=23160523 polypeptide=Lus10023434 locus=Lus10023434.g ID=Lus10023434.BGIv1.0 annot-version=v1.0 ATGTCGAGTAATGGAAGAAGGTGCGCAGGGTGTAAGTATCTGAGAAGAAGATGCGCGCAAGATTGCGTGCTGGCTCCTTATTTCCCTCCAGACAATCCAC AAAGATTCGAATCCGTCCACAAGATTTTTGGTGCCAGCAACCTCACCAGACTCTTACAGGAAGTGCCGGTGGAAACGAGAGGGAAGGCAGCAGACTGCAT GTCGTTCGAGGCGAGTGCGAGAGCCAGAGAGCCAGTGTACGGATGTGCCGGAATGATACATGAACTCCAGCAGGAGATACTGAAGGTGCAATTCGAGGTG GAGAACATTGAAGGGATGTTAGCTCTGCACAGAGCAGAGCATCAGCTTTTAGTTATGAGGCAGCAAGAGAAGAAAAATATGTTACTAGACGACGATGATG TTGATTTTGGTGGACATTATAACTTAGACTTGGAGGGTGATGATCAGTTTCTATGGCAATTGACTTGA
AA sequence Show only first row Show all	>Lus10023434 pacid=23160523 polypeptide=Lus10023434 locus=Lus10023434.g ID=Lus10023434.BGIv1.0 annot-version=v1.0 MSSNGRRCAGCKYLRRRCAQDCVLAPYFPPDNPQRFESVHKIFGASNLTRLLQEVPVETRGKAADCMSFEASARAREPVYGCAGMIHELQQEILKVQFEV ENIEGMLALHRAEHQLLVMRQQEKKNMLLDDDDVDFGGHYNLDLEGDDQFLWQLT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G26660	AS2	LBD24	LOB domain-containing protein ...		Lus10023434 [exp]	0	1
					Lus10005203 [exp]	1.4	0.7098
AT1G02335		GL22	germin-like protein subfamily ...		Lus10004855 [exp]	6.8	0.6920
AT5G27750			F-box/FBD-like domains contain...		Lus10035326 [exp]	7.3	0.5608
AT3G09590			CAP (Cysteine-rich secretory p...		Lus10025279 [exp]	10.4	0.5875
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10031480 [exp]	10.6	0.6011
					Lus10017410 [exp]	13.0	0.5835
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10028506 [exp]	15.7	0.5473
AT3G04620		DAN1	D NUCLDUO1-ACTIVATEEIC ACID BI...		Lus10005531 [exp]	25.1	0.5533
					Lus10022162 [exp]	33.0	0.5427
AT4G33985			Protein of unknown function (D...		Lus10002400 [exp]	36.6	0.5874

Compare expression of checked genes

Lus10023434 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.