Lus10023449 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G02610 150 / 8e-48 Ribosomal L29 family protein (.1.2)
AT2G39390 150 / 9e-48 Ribosomal L29 family protein (.1)
AT3G09500 148 / 6e-47 Ribosomal L29 family protein (.1)
AT3G55170 145 / 9e-46 Ribosomal L29 family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003306 162 / 1e-52 AT3G09500 218 / 6e-75 Ribosomal L29 family protein (.1)
Lus10030314 160 / 9e-52 AT3G09500 214 / 2e-73 Ribosomal L29 family protein (.1)
Lus10019179 156 / 3e-50 AT5G02610 210 / 7e-72 Ribosomal L29 family protein (.1.2)
Lus10025292 152 / 9e-49 AT5G02610 221 / 5e-76 Ribosomal L29 family protein (.1.2)
Lus10024437 146 / 4e-46 AT5G02610 218 / 6e-75 Ribosomal L29 family protein (.1.2)
Lus10019180 112 / 6e-33 AT5G02610 172 / 4e-57 Ribosomal L29 family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G212300 156 / 3e-50 AT2G39390 213 / 4e-73 Ribosomal L29 family protein (.1)
Potri.006G214200 154 / 3e-49 AT2G39390 186 / 3e-62 Ribosomal L29 family protein (.1)
Potri.008G048800 152 / 1e-48 AT5G02610 177 / 1e-58 Ribosomal L29 family protein (.1.2)
Potri.006G214100 151 / 4e-48 AT2G39390 189 / 2e-63 Ribosomal L29 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0346 Ribo_L29 PF00831 Ribosomal_L29 Ribosomal L29 protein
Representative CDS sequence
>Lus10023449 pacid=23160603 polypeptide=Lus10023449 locus=Lus10023449.g ID=Lus10023449.BGIv1.0 annot-version=v1.0
ATGCAATTCCAGCCGCCGGTGAAGAGAACGTCAGAAAATACACTCGTAAAATCCAGAATCAAGGTCCACGAGCTGAGGCTGAAGAACAAGTTGGAACTTT
TGAATCAGCTCAAGGATCTCAAGGCTGAGCTTGCTCTTCTCCGCGTCGCCAAGGTCACCGGCGGCGCTCCTAACAAGCTGTCCAAGATCAAGGTGGTGCG
GTTGTCTATTGCCCAAGTGTTGACAGTGATCTCACAGAAGCAGAAAGCTGCACTTCGTGAAGTGTACAAGAACAAGAAGCTGTTGCCTCTTGACCTCCGT
CCCAAGAAGACCAGAGCCATCAGAAGGAGGCTTACCAAGCACCAGCAATCTCTTAAGACGGAGAGGGAGAAGAAGAGGGAAATGTACTTCCCCATGAGGA
AGTATGCGATCAAGGTGTAG
AA sequence
>Lus10023449 pacid=23160603 polypeptide=Lus10023449 locus=Lus10023449.g ID=Lus10023449.BGIv1.0 annot-version=v1.0
MQFQPPVKRTSENTLVKSRIKVHELRLKNKLELLNQLKDLKAELALLRVAKVTGGAPNKLSKIKVVRLSIAQVLTVISQKQKAALREVYKNKKLLPLDLR
PKKTRAIRRRLTKHQQSLKTEREKKREMYFPMRKYAIKV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G02610 Ribosomal L29 family protein ... Lus10023449 0 1
AT2G20450 Ribosomal protein L14 (.1) Lus10021170 2.0 0.9652
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10023457 2.0 0.9595
AT2G43360 BIOB, BIO2 BIOTIN AUXOTROPH B, BIOTIN AUX... Lus10027018 6.2 0.9348
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10014035 7.4 0.9468
AT2G20450 Ribosomal protein L14 (.1) Lus10011807 9.6 0.9485
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10023454 9.6 0.9491
AT4G09320 NDPK1 Nucleoside diphosphate kinase ... Lus10024286 9.9 0.9396
AT4G39200 Ribosomal protein S25 family p... Lus10021706 13.0 0.9392
AT3G16080 Zinc-binding ribosomal protein... Lus10037549 13.2 0.9463
AT5G15200 Ribosomal protein S4 (.1.2) Lus10008624 14.1 0.9467

Lus10023449 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.