Lus10023457 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G34480 337 / 2e-120 Ribosomal protein L18ae/LX family protein (.1)
AT3G14600 335 / 2e-119 Ribosomal protein L18ae/LX family protein (.1)
AT1G29965 328 / 7e-117 Ribosomal protein L18ae/LX family protein (.1)
AT1G29970 324 / 3e-113 RPL18AA 60S ribosomal protein L18A-1 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019881 370 / 2e-133 AT2G34480 337 / 4e-120 Ribosomal protein L18ae/LX family protein (.1)
Lus10023454 370 / 2e-133 AT2G34480 337 / 4e-120 Ribosomal protein L18ae/LX family protein (.1)
Lus10014035 373 / 2e-131 AT2G34480 338 / 2e-117 Ribosomal protein L18ae/LX family protein (.1)
Lus10040332 312 / 7e-111 AT2G34480 290 / 4e-102 Ribosomal protein L18ae/LX family protein (.1)
Lus10023456 160 / 1e-51 AT2G34480 147 / 1e-46 Ribosomal protein L18ae/LX family protein (.1)
Lus10023453 121 / 3e-36 AT2G34480 112 / 4e-33 Ribosomal protein L18ae/LX family protein (.1)
Lus10028130 42 / 0.0001 AT1G29970 150 / 6e-45 60S ribosomal protein L18A-1 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G057600 357 / 2e-128 AT2G34480 342 / 3e-122 Ribosomal protein L18ae/LX family protein (.1)
Potri.004G063400 350 / 1e-125 AT2G34480 345 / 1e-123 Ribosomal protein L18ae/LX family protein (.1)
Potri.004G063300 350 / 1e-125 AT2G34480 345 / 1e-123 Ribosomal protein L18ae/LX family protein (.1)
Potri.011G072400 350 / 2e-125 AT2G34480 349 / 4e-125 Ribosomal protein L18ae/LX family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01775 Ribosomal_L18A Ribosomal proteins 50S-L18Ae/60S-L20/60S-L18A
Representative CDS sequence
>Lus10023457 pacid=23160464 polypeptide=Lus10023457 locus=Lus10023457.g ID=Lus10023457.BGIv1.0 annot-version=v1.0
ATGGTTGCTTACAGGTATCACCAGTACCAGGTTGTGGGGCGAGCTCTGCCGACTGAGAGCGATGAACATCCCAAGATCTACAGGATGAAGCTGTGGCATA
CTAATGAGGTTCGCGCCAAATCCAAGTTCTGGTACTTTCTGAGGAAGCTGAAGAAGGTGAAGAAAAGCAATGGCCAGATGCTCGCTATCAACGAGATTTT
TGAGAAGAACCCCACTAAAATCAAGAACTACGGCATTTGGCTACGATACCAGAGCAGAACGGGCTATCACAACATGTACAAGGAGTTCCGTGACACCACC
TTGAATGGAGCTGTCGAACAGATGTACGACGAGATGGCTTCTCGCCACAGGGTGAGGTCTCCTTGCATCCAGATCATCAAGACTGCCACCATCCCGGCCA
AGCTGTGCAAGAGGGAGAGCACCAAGCAATTCCACAACTCTAAGATCAAATTCCCGTTGGTGTTTAAGAAGGTTAGGCCACCGACCAGGAAGCTGAAGAC
CACATACAAGGCGTCCAGGCCCAACTTGTTTGTCTAA
AA sequence
>Lus10023457 pacid=23160464 polypeptide=Lus10023457 locus=Lus10023457.g ID=Lus10023457.BGIv1.0 annot-version=v1.0
MVAYRYHQYQVVGRALPTESDEHPKIYRMKLWHTNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTT
LNGAVEQMYDEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10023457 0 1
AT4G39200 Ribosomal protein S25 family p... Lus10021706 1.0 0.9651
AT5G02610 Ribosomal L29 family protein ... Lus10023449 2.0 0.9595
AT1G09690 Translation protein SH3-like f... Lus10029302 3.9 0.9565
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10040332 4.9 0.9581
AT3G16080 Zinc-binding ribosomal protein... Lus10037549 5.7 0.9590
AT2G30260 U2B'' U2 small nuclear ribonucleopro... Lus10042240 6.2 0.9311
AT4G29410 Ribosomal L28e protein family ... Lus10012915 6.6 0.9299
AT2G43360 BIOB, BIO2 BIOTIN AUXOTROPH B, BIOTIN AUX... Lus10027018 7.3 0.9339
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10014035 8.9 0.9492
AT2G20450 Ribosomal protein L14 (.1) Lus10021170 9.9 0.9493

Lus10023457 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.