Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12345 92 / 7e-25 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040344 [exp] 119 / 1e-35 AT3G12345 167 / 9e-53 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G047800 [exp] 101 / 1e-28 AT3G12345 143 / 3e-43 unknown protein Potri.010G213600 [exp] 99 / 1e-27 AT3G12345 144 / 8e-44 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023468 pacid=23160543 polypeptide=Lus10023468 locus=Lus10023468.g ID=Lus10023468.BGIv1.0 annot-version=v1.0 ATGAAAGTGGAGTTCGGATTCAATCCTTACAGCGAGAAAGTGAACGGAAGGATCTCGTTCCTGGGGCTGGCGGCTCTGCTGCTGGTGGAGCTGGCGACGG GGAAGAGCATGCTCAGCTACCACACGCCGGCGATCGTGATGGTTCAGATCTACTTCGTGGCGGCGGTATCGGCGGTGTATATGAAGTACGAGAAGGAGAA GATTAGCGTCTGGCCCCGTCCAAAGAATGATGCTAATTAG
AA sequence Show only first row Show all	>Lus10023468 pacid=23160543 polypeptide=Lus10023468 locus=Lus10023468.g ID=Lus10023468.BGIv1.0 annot-version=v1.0 MKVEFGFNPYSEKVNGRISFLGLAALLLVELATGKSMLSYHTPAIVMVQIYFVAAVSAVYMKYEKEKISVWPRPKNDAN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12345			unknown protein		Lus10023468 [exp]	0	1
AT2G30570		PSBW	photosystem II reaction center...		Lus10024858 [exp]	2.8	0.9474
AT1G06680		PSII-P, OEE2, P...	OXYGEN-EVOLVING ENHANCER PROTE...		Lus10020717 [exp]	5.8	0.9344
AT4G13220			unknown protein		Lus10022819 [exp]	6.7	0.9197
AT1G55670		PSAG	photosystem I subunit G (.1)		Lus10017476 [exp]	8.3	0.9322
AT1G32220			NAD(P)-binding Rossmann-fold s...		Lus10010419 [exp]	10.7	0.8927
AT1G55670		PSAG	photosystem I subunit G (.1)		Lus10028806 [exp]	12.2	0.9281
AT3G50820		OEC33, PSBO2, P...	OXYGEN EVOLVING COMPLEX SUBUNI...		Lus10016783 [exp]	14.5	0.9216
AT3G48420			Haloacid dehalogenase-like hyd...		Lus10013663 [exp]	14.7	0.9316
AT4G22890		PGR5-LIKEA, PGR...	PGR5-LIKE A (.1.2.3.4.5)		Lus10014135 [exp]	15.3	0.9252
AT5G02120		PDE335, OHP	PIGMENT DEFECTIVE 335, one hel...		Lus10003965 [exp]	19.3	0.9139

Compare expression of checked genes

Lus10023468 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.