Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76810 223 / 2e-68 eukaryotic translation initiation factor 2 (eIF-2) family protein (.1) AT1G76720 216 / 4e-66 eukaryotic translation initiation factor 2 (eIF-2) family protein (.1) AT1G76820 214 / 1e-65 eukaryotic translation initiation factor 2 (eIF-2) family protein (.1) AT1G21160 206 / 1e-62 eukaryotic translation initiation factor 2 (eIF-2) family protein (.1) AT2G27700 173 / 3e-53 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein (.1.2) AT4G11160 86 / 2e-20 Translation initiation factor 2, small GTP-binding protein (.1) AT1G17220 78 / 8e-18 FUG1 fu-gaeri1, Translation initiation factor 2, small GTP-binding protein (.1) AT5G08650 45 / 2e-06 Small GTP-binding protein (.1) AT5G39900 43 / 1e-05 Small GTP-binding protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012856 [exp] 225 / 3e-69 AT1G76820 1211 / 0.0 eukaryotic translation initiation factor 2 (eIF-2) family protein (.1) Lus10030500 [exp] 224 / 5e-69 AT1G76810 1217 / 0.0 eukaryotic translation initiation factor 2 (eIF-2) family protein (.1) Lus10005581 [exp] 86 / 2e-20 AT1G17220 1080 / 0.0 fu-gaeri1, Translation initiation factor 2, small GTP-binding protein (.1) Lus10013713 [exp] 82 / 4e-19 AT1G17220 1267 / 0.0 fu-gaeri1, Translation initiation factor 2, small GTP-binding protein (.1) Lus10033933 [exp] 72 / 1e-15 AT4G11160 927 / 0.0 Translation initiation factor 2, small GTP-binding protein (.1) Lus10040356 [exp] 52 / 2e-09 AT1G76810 56 / 2e-10 eukaryotic translation initiation factor 2 (eIF-2) family protein (.1) Lus10025694 [exp] 45 / 3e-06 AT5G08650 1009 / 0.0 Small GTP-binding protein (.1) Lus10035968 [exp] 45 / 4e-06 AT5G08650 1102 / 0.0 Small GTP-binding protein (.1) Lus10007250 [exp] 45 / 4e-06 AT5G39900 1080 / 0.0 Small GTP-binding protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G039200 [exp] 224 / 6e-69 AT1G76810 1096 / 0.0 eukaryotic translation initiation factor 2 (eIF-2) family protein (.1) Potri.019G103600 [exp] 201 / 8e-61 AT1G76810 976 / 0.0 eukaryotic translation initiation factor 2 (eIF-2) family protein (.1) Potri.001G095500 [exp] 82 / 3e-19 AT4G11160 828 / 0.0 Translation initiation factor 2, small GTP-binding protein (.1) Potri.001G436300 [exp] 78 / 8e-18 AT1G17220 1076 / 0.0 fu-gaeri1, Translation initiation factor 2, small GTP-binding protein (.1) Potri.011G140100 [exp] 77 / 2e-17 AT1G17220 1160 / 0.0 fu-gaeri1, Translation initiation factor 2, small GTP-binding protein (.1) Potri.011G132300 [exp] 58 / 5e-11 AT1G76820 145 / 5e-40 eukaryotic translation initiation factor 2 (eIF-2) family protein (.1) Potri.011G132100 [exp] 58 / 5e-11 AT1G76820 145 / 5e-40 eukaryotic translation initiation factor 2 (eIF-2) family protein (.1) Potri.017G079800 [exp] 49 / 2e-07 AT5G39900 999 / 0.0 Small GTP-binding protein (.1) Potri.001G305300 [exp] 45 / 4e-06 AT5G08650 1063 / 0.0 Small GTP-binding protein (.1) Potri.014G138100 [exp] 38 / 0.001 AT4G02930 752 / 0.0 GTP binding Elongation factor Tu family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00009 [flax] [poplar] GTP_EFTU Elongation factor Tu GTP binding domain
Representative CDS sequence Show only first row Show all	>Lus10023474 pacid=23160590 polypeptide=Lus10023474 locus=Lus10023474.g ID=Lus10023474.BGIv1.0 annot-version=v1.0 ATGGGGCATGTGGAAACGGGCAAGACGACGCTTCTGGATTGTATTAGAGGAAGCAATGTGCAGGAAGGTGAGGCAGGGGGTATCACGCAGCAAAGCGGTG CGACGTACTTTCCTTCCGAGAACATAAGAGAGCAAACTAAAGAATTGAAGGATGACGCGAAGCTGAAGGTTCCTGGTTTGTTGGTTATTGACACCCCTGG CCACGAATCGATAACCGAACTTCGTTCGAGAGGGTCGGGGTTATGTGATATTTCTGTTTTGGTTGTTGATATCATGCATGGGTTGGAGCCGCAGACGGTA GAGTCTCTCAATCTGTTGAGAATGAGGAACAACGAATTCATCGTTGCCTTAAATAAGGTACGTGATCTGTAA
AA sequence Show only first row Show all	>Lus10023474 pacid=23160590 polypeptide=Lus10023474 locus=Lus10023474.g ID=Lus10023474.BGIv1.0 annot-version=v1.0 MGHVETGKTTLLDCIRGSNVQEGEAGGITQQSGATYFPSENIREQTKELKDDAKLKVPGLLVIDTPGHESITELRSRGSGLCDISVLVVDIMHGLEPQTV ESLNLLRMRNNEFIVALNKVRDL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G76810			eukaryotic translation initiat...		Lus10023474 [exp]	0	1
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Lus10023047 [exp]	2.6	0.9962
AT5G12060			Plant self-incompatibility pro...		Lus10023195 [exp]	3.7	0.9962
AT5G17600			RING/U-box superfamily protein...		Lus10008458 [exp]	4.6	0.9962
AT4G35610	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10035994 [exp]	5.3	0.9947
AT5G07480		KUOX1	KAR-UP oxidoreductase 1 (.1)		Lus10043000 [exp]	5.9	0.9947
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10030505 [exp]	6.5	0.9939
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Lus10023022 [exp]	7.0	0.9925
AT1G04110		SDD1	STOMATAL DENSITY AND DISTRIBUT...		Lus10007046 [exp]	7.7	0.7402
AT5G02930			F-box/RNI-like superfamily pro...		Lus10040452 [exp]	7.9	0.8912
AT5G54010			UDP-Glycosyltransferase superf...		Lus10008453 [exp]	8.0	0.9921

Compare expression of checked genes

Lus10023474 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.