Lus10023483 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G54970 229 / 7e-75 D-aminoacid aminotransferase-like PLP-dependent enzymes superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040366 316 / 8e-106 AT3G54970 347 / 1e-115 D-aminoacid aminotransferase-like PLP-dependent enzymes superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G216500 263 / 3e-88 AT3G54970 338 / 3e-115 D-aminoacid aminotransferase-like PLP-dependent enzymes superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01063 Aminotran_4 Amino-transferase class IV
Representative CDS sequence
>Lus10023483 pacid=23160617 polypeptide=Lus10023483 locus=Lus10023483.g ID=Lus10023483.BGIv1.0 annot-version=v1.0
ATGCTGGACGTGTATGTACGCCTTGGTGGCTATGTTCCTCCGGCGTTCGGTGGATCAGGGACTATGGCGAGATTGGCTGTTGTAGGTCAAGGAAGATGCT
TGGCCGAAGCTAAGTATTCGGATTGGGTAAGGATAAGGAAGCCACTGGAGAGGTTGAGGCCTCCTTTAGTGACGGAGCTCCTGTTGTCCAACGATGGCGA
TCATTTGCTTGAAGGCTTGGTCACAAATTTCTTCGTTGTTTGTCGGAAGGTGAGATTCAGTAAGGGAAATCAGCTGTACATTCTTAGCTCTGTAGTTCAT
CAAAAAAACAATGGAGCTGGTGAAAATGGATATCCCTTTGAAGTGCAAACAGCTCCGCTTGCCGATGGTGTTCTTCCAGGAGTAATCCGTCAACTAGTCA
TCGAAGTGTGCTTAAGCAAGGGGATTGCAGTTCAAGAAGTTGCTCCATCATGGTCAAAGCGTGAATCTTGGCAAGAAGCATTTGTTACAAGTAGCCTGAG
AATCGTGCAGCACGTGGAAAGAATCCAATTCCCACATTCATGGGAATCATTAGAACAGAAATCTCCAGAAGAGATCTCGTGGGATGAAAAGCAGTTTGAG
AATGAGATAATGAAGAAGGCGATCCTGGAAGGGTATCCATTGTGA
AA sequence
>Lus10023483 pacid=23160617 polypeptide=Lus10023483 locus=Lus10023483.g ID=Lus10023483.BGIv1.0 annot-version=v1.0
MLDVYVRLGGYVPPAFGGSGTMARLAVVGQGRCLAEAKYSDWVRIRKPLERLRPPLVTELLLSNDGDHLLEGLVTNFFVVCRKVRFSKGNQLYILSSVVH
QKNNGAGENGYPFEVQTAPLADGVLPGVIRQLVIEVCLSKGIAVQEVAPSWSKRESWQEAFVTSSLRIVQHVERIQFPHSWESLEQKSPEEISWDEKQFE
NEIMKKAILEGYPL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G54970 D-aminoacid aminotransferase-l... Lus10023483 0 1
AT1G33400 TPR9 tetratricopeptide repeat 9, Te... Lus10026202 10.3 0.7542
AT1G47550 SEC3A exocyst complex component sec3... Lus10015090 19.5 0.7432
AT5G02130 NDP1 Tetratricopeptide repeat (TPR)... Lus10010858 27.0 0.6706
AT2G36290 alpha/beta-Hydrolases superfam... Lus10041666 27.2 0.7140
AT1G47550 SEC3A exocyst complex component sec3... Lus10032737 41.3 0.6908
AT1G77800 PHD finger family protein (.1.... Lus10009786 52.1 0.6815
AT2G30320 Pseudouridine synthase family ... Lus10042233 154.0 0.6072
AT1G26180 unknown protein Lus10031917 161.7 0.6235
AT5G27620 CYCH;1 cyclin H;1 (.1) Lus10017091 176.2 0.6111
AT4G36860 DAR1 DA1-RELATED PROTEIN 1, LIM dom... Lus10000138 190.4 0.5886

Lus10023483 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.