Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) AT3G05880 87 / 6e-25 RCI2A RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) AT3G05890 79 / 6e-22 RCI2B RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) AT1G57550 74 / 1e-19 Low temperature and salt responsive protein family (.1) AT4G30650 67 / 5e-17 Low temperature and salt responsive protein family (.1) AT4G30660 66 / 1e-16 Low temperature and salt responsive protein family (.1.2) AT2G24040 65 / 4e-16 Low temperature and salt responsive protein family (.1) AT4G28088 64 / 7e-16 Low temperature and salt responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040370 [exp] 102 / 5e-31 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10029449 [exp] 82 / 9e-23 ND 89 / 1e-25 Lus10019890 [exp] 78 / 2e-21 AT3G05880 85 / 3e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10014028 [exp] 78 / 3e-21 AT3G05880 84 / 5e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10029450 [exp] 77 / 5e-21 ND 87 / 6e-25 Lus10005948 [exp] 76 / 5e-20 ND 85 / 5e-23 Lus10036592 [exp] 66 / 3e-16 AT4G30660 116 / 4e-36 Low temperature and salt responsive protein family (.1.2) Lus10035809 [exp] 66 / 3e-16 AT4G30660 116 / 5e-36 Low temperature and salt responsive protein family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G044300 [exp] 100 / 2e-30 AT2G38905 100 / 4e-30 Low temperature and salt responsive protein family (.1) Potri.010G217200 [exp] 99 / 1e-29 AT2G38905 98 / 2e-29 Low temperature and salt responsive protein family (.1) Potri.013G001600 [exp] 84 / 1e-23 AT3G05880 70 / 3e-18 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.005G002100 [exp] 78 / 2e-21 AT3G05880 68 / 1e-17 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.005G002250 [exp] 77 / 3e-21 AT3G05890 66 / 2e-16 RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) Potri.006G182500 [exp] 66 / 2e-16 AT4G28088 91 / 5e-26 Low temperature and salt responsive protein family (.1) Potri.018G105100 [exp] 61 / 1e-14 AT4G28088 91 / 1e-25 Low temperature and salt responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01679 [flax] [poplar] Pmp3 Proteolipid membrane potential modulator
Representative CDS sequence Show only first row Show all	>Lus10023489 pacid=23160542 polypeptide=Lus10023489 locus=Lus10023489.g ID=Lus10023489.BGIv1.0 annot-version=v1.0 ATGGGTTCAGAGACATTCCTAGAGGTGATACTAGCCATCCTCCTACCGCCGGTCGGCGTCTTCCTCCGGTACGGCTGTGGGGTTGAATTCTGGATATGCT TATTGCTTACCATACTGGGATATATTCCTGGTATCATATACGCCATCTATGTCCTAGTCGGATAG
AA sequence Show only first row Show all	>Lus10023489 pacid=23160542 polypeptide=Lus10023489 locus=Lus10023489.g ID=Lus10023489.BGIv1.0 annot-version=v1.0 MGSETFLEVILAILLPPVGVFLRYGCGVEFWICLLLTILGYIPGIIYAIYVLVG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38905			Low temperature and salt respo...		Lus10023489 [exp]	0	1
AT5G27440			unknown protein		Lus10041604 [exp]	7.5	0.6898
AT2G18245			alpha/beta-Hydrolases superfam...		Lus10028314 [exp]	13.6	0.6251
AT5G63690			Nucleic acid-binding, OB-fold-...		Lus10035799 [exp]	16.5	0.6273
AT2G40890		REF8, CYP98A3, ...	cytochrome P450, family 98, su...		Lus10020849 [exp]	25.4	0.6380
AT3G47810		ATVPS29, MAG1	VACUOLAR PROTEIN SORTING 29, M...		Lus10012851 [exp]	39.6	0.6043
AT5G01090			Concanavalin A-like lectin fam...		Lus10027751 [exp]	43.5	0.5898
AT2G35470			unknown protein		Lus10030980 [exp]	44.2	0.5795
AT2G38130		ATMAK3	Acyl-CoA N-acyltransferases (N...		Lus10012579 [exp]	57.3	0.5767
AT3G14180	Trihelix	ASIL2	Arabidopsis 6B-interacting pr...		Lus10008141 [exp]	74.0	0.5445
AT5G42300		UBL5	ubiquitin-like protein 5 (.1)		Lus10019939 [exp]	88.7	0.5303

Compare expression of checked genes

Lus10023489 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.