Lus10023492 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52300 295 / 6e-104 ATPQ "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040374 338 / 8e-121 AT3G52300 293 / 3e-103 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Lus10023337 312 / 1e-110 AT3G52300 298 / 2e-105 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Lus10038474 310 / 5e-110 AT3G52300 297 / 7e-105 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G043800 298 / 4e-105 AT3G52300 291 / 3e-102 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Potri.010G217800 290 / 5e-102 AT3G52300 281 / 1e-98 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05873 Mt_ATP-synt_D ATP synthase D chain, mitochondrial (ATP5H)
Representative CDS sequence
>Lus10023492 pacid=23160462 polypeptide=Lus10023492 locus=Lus10023492.g ID=Lus10023492.BGIv1.0 annot-version=v1.0
ATGAGCGGAACGGTGAAGAAAGCAGCTGATGTTGCGTTCAAGGCGTCGAAGAACATTGATTGGGAAGGTATGGCCAAGCTCCTTGTCTCCGATGAGGCTC
GCAAGGAGTTCTCCGGCCTCCGTCGCGCTTTCGATGAGGTCAATTCCACTCTCCAGACCAAATTTAGCCAGGAGCCTGAACCCATAGATTGGGAGTATTA
CAGGAAAGGAATTGGCTCACGCTTGGTGGATATGTACAAAGAGGCTTATGACAGCGTCGAAGTCCCGAAGTATGTAGACAAAGTGACTCCGGAATACAAG
CCTAAATTTGAGGCCTTGATGGTTGAATTGAAGGAAGCAGAGCAGATGTCTCTGAAGGAGTCCGAACGTTTGGAGAAGGAAATCGCCGAAGTCCAAGAGC
TCAAGAAAAAGATCAGCACCATGACTGCAGATGAGTATTTCGAGAAGCATCCGGAGCTGAAGAAGAAGTTTGATGACGAAATCAGGAACGACTACTGGGG
CTATTGA
AA sequence
>Lus10023492 pacid=23160462 polypeptide=Lus10023492 locus=Lus10023492.g ID=Lus10023492.BGIv1.0 annot-version=v1.0
MSGTVKKAADVAFKASKNIDWEGMAKLLVSDEARKEFSGLRRAFDEVNSTLQTKFSQEPEPIDWEYYRKGIGSRLVDMYKEAYDSVEVPKYVDKVTPEYK
PKFEALMVELKEAEQMSLKESERLEKEIAEVQELKKKISTMTADEYFEKHPELKKKFDDEIRNDYWGY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Lus10023492 0 1
AT5G20500 Glutaredoxin family protein (.... Lus10017148 1.0 0.9527
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Lus10040374 2.0 0.9399
AT3G60820 PBF1 N-terminal nucleophile aminohy... Lus10015867 3.5 0.9200
AT3G03100 NADH:ubiquinone oxidoreductase... Lus10030358 6.9 0.9031
AT2G27020 PAG1 20S proteasome alpha subunit G... Lus10037416 7.5 0.9086
AT5G17250 Alkaline-phosphatase-like fami... Lus10006806 8.7 0.8909
AT1G04850 ubiquitin-associated (UBA)/TS-... Lus10037827 8.9 0.9162
AT5G40810 Cytochrome C1 family (.1.2) Lus10041577 9.4 0.9191
AT1G19580 GAMMACA1 ,GAMMA... gamma carbonic anhydrase 1 (.1... Lus10028321 11.0 0.9106
AT5G13050 5-FCL 5-formyltetrahydrofolate cyclo... Lus10004254 13.4 0.8819

Lus10023492 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.