Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09700 135 / 3e-43 Chaperone DnaJ-domain superfamily protein (.1) AT5G03030 135 / 4e-43 Chaperone DnaJ-domain superfamily protein (.1) AT2G35795 131 / 1e-41 Chaperone DnaJ-domain superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040376 [exp] 158 / 5e-49 AT5G03030 184 / 6e-58 Chaperone DnaJ-domain superfamily protein (.1) Lus10041420 [exp] 141 / 4e-45 AT2G35795 194 / 2e-65 Chaperone DnaJ-domain superfamily protein (.1) Lus10036507 [exp] 112 / 1e-33 AT2G35795 163 / 3e-53 Chaperone DnaJ-domain superfamily protein (.1) Lus10015065 [exp] 98 / 1e-28 AT2G35795 118 / 3e-36 Chaperone DnaJ-domain superfamily protein (.1) Lus10019915 [exp] 97 / 2e-25 AT5G28540 321 / 2e-101 heat shock protein 70 (Hsp 70) family protein (.1) Lus10026485 [exp] 83 / 2e-21 AT1G09080 124 / 2e-36 binding protein 3, Heat shock protein 70 (Hsp 70) family protein (.1), Heat shock protein 70 (Hsp 70) family protein (.2) Lus10002733 [exp] 42 / 5e-06 AT5G22060 299 / 6e-100 ARABIDOPSIS THALIANA DNAJ HOMOLOGUE 2, DNAJ homologue 2 (.1) Lus10008652 [exp] 42 / 5e-06 AT5G22060 300 / 5e-100 ARABIDOPSIS THALIANA DNAJ HOMOLOGUE 2, DNAJ homologue 2 (.1) Lus10042891 [exp] 41 / 2e-05 AT5G22060 554 / 0.0 ARABIDOPSIS THALIANA DNAJ HOMOLOGUE 2, DNAJ homologue 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G131200 [exp] 137 / 4e-44 AT2G35795 195 / 2e-66 Chaperone DnaJ-domain superfamily protein (.1) Potri.008G043500 [exp] 131 / 1e-41 AT2G35795 179 / 4e-60 Chaperone DnaJ-domain superfamily protein (.1) Potri.012G038800 [exp] 122 / 4e-38 AT2G35795 160 / 3e-52 Chaperone DnaJ-domain superfamily protein (.1) Potri.010G243100 [exp] 41 / 1e-05 AT3G44110 528 / 0.0 DNAJ homologue 3 (.1.2) Potri.002G141100 [exp] 40 / 2e-05 AT3G44110 504 / 3e-178 DNAJ homologue 3 (.1.2) Potri.008G018800 [exp] 40 / 2e-05 AT3G44110 528 / 0.0 DNAJ homologue 3 (.1.2) Potri.009G015700 [exp] 40 / 3e-05 AT3G44110 629 / 0.0 DNAJ homologue 3 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [flax] [poplar] Chaperone-J PF00226 [flax] [poplar] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Lus10023494 pacid=23160621 polypeptide=Lus10023494 locus=Lus10023494.g ID=Lus10023494.BGIv1.0 annot-version=v1.0 ATGCGCAGATTCTATGAAGGTGGTTTTCAGGCTCAGATGACTAGAAGAGAAGCAGCTCTAATTCTTGGTCTTAGGGAAAGTGCGGCGCAAGACAAGATCA AGGAAGCGCATAGAAGAGTAATGGTGGCGAACCATCCCGATGCAGGTGGTAGCGGTTACCTGGCTTCAAAGGTCAATGAAGCCAAAGATGTGATGCTTGG GAAGACAAAGGGGAGTGGTTCTGCTTTCTAA
AA sequence Show only first row Show all	>Lus10023494 pacid=23160621 polypeptide=Lus10023494 locus=Lus10023494.g ID=Lus10023494.BGIv1.0 annot-version=v1.0 MRRFYEGGFQAQMTRREAALILGLRESAAQDKIKEAHRRVMVANHPDAGGSGYLASKVNEAKDVMLGKTKGSGSAF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G03030			Chaperone DnaJ-domain superfam...		Lus10023494 [exp]	0	1
AT5G03030			Chaperone DnaJ-domain superfam...		Lus10040376 [exp]	2.0	0.9404
AT1G11905			B-cell receptor-associated pro...		Lus10000048 [exp]	2.2	0.9496
AT2G01100			unknown protein		Lus10025460 [exp]	4.9	0.9240
AT2G28430			unknown protein		Lus10021477 [exp]	4.9	0.9292
AT3G07440			unknown protein		Lus10020404 [exp]	6.5	0.9343
AT1G36310			S-adenosyl-L-methionine-depend...		Lus10040430 [exp]	9.5	0.9203
AT1G11890		ATSEC22, SEC22	SECRETION 22, Synaptobrevin fa...		Lus10013175 [exp]	10.6	0.9108
AT5G11950		LOG8	LONELY GUY 8, Putative lysine ...		Lus10026131 [exp]	10.7	0.9297
AT1G72690			unknown protein		Lus10015607 [exp]	14.5	0.9176
AT4G22310			Uncharacterised protein family...		Lus10023745 [exp]	14.7	0.9324

Compare expression of checked genes

Lus10023494 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.