Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040396 [exp] 46 / 2e-07 AT5G54740 62 / 2e-12 seed storage albumin 5 (.1) Lus10023513 [exp] 37 / 0.0006 AT5G54740 60 / 1e-11 seed storage albumin 5 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10023514 pacid=23160486 polypeptide=Lus10023514 locus=Lus10023514.g ID=Lus10023514.BGIv1.0 annot-version=v1.0 ATGGACGATGACAACTACTACTACTACAACCAGCAGGAACAACAACAACACTACAACGAATGCTGCAGCGAGTTGAAGCAACTCAGCACCCAGTGCACTT GCAGAGGACTTGAGAAGGCGATGAAGCAGGCGCAGAAGCAGGTGCAGGGTGGGCAGCAGGGGTTGGAGCAAGTTAGGAGGATGGTTGAGGAGCTTCCTGG TAGGTGCGGTACTCAGCCTACCCGATGTGGAGGCCAAGGGCAAGGAGGATCTGTGGCTGAATGGATTTAA
AA sequence Show only first row Show all	>Lus10023514 pacid=23160486 polypeptide=Lus10023514 locus=Lus10023514.g ID=Lus10023514.BGIv1.0 annot-version=v1.0 MDDDNYYYYNQQEQQQHYNECCSELKQLSTQCTCRGLEKAMKQAQKQVQGGQQGLEQVRRMVEELPGRCGTQPTRCGGQGQGGSVAEWI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G54740		SESA5	seed storage albumin 5 (.1)		Lus10023514 [exp]	0	1
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10013921 [exp]	1.4	0.9696
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10013922 [exp]	3.2	0.9405
AT5G51890			Peroxidase superfamily protein...		Lus10038054 [exp]	6.7	0.9397
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10017014 [exp]	7.5	0.9058
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10006700 [exp]	15.7	0.8818
AT2G15220			Plant basic secretory protein ...		Lus10001359 [exp]	17.7	0.8501
					Lus10021010 [exp]	19.3	0.9265
AT5G26650	MADS	AGL36	AGAMOUS-like 36 (.1)		Lus10016180 [exp]	20.0	0.8422
AT2G43820		SGT1, ATSAGT1, ...	UDP-glucose:salicylic acid glu...		Lus10017826 [exp]	28.2	0.8573
					Lus10011681 [exp]	28.8	0.9103

Compare expression of checked genes

Lus10023514 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.