Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040404 [exp] 54 / 2e-09 AT3G54810 115 / 2e-28 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023520 pacid=23160632 polypeptide=Lus10023520 locus=Lus10023520.g ID=Lus10023520.BGIv1.0 annot-version=v1.0 ATGAGCTCGTCTGGTCTGCCGAGCAACGTACGACAAGGACCACTCCGTTTCTACAAGATCGTCACTAACGACTCCCTCCGTCACAGGAAGCTCTATCTGA GGGATTTTACGTTTTCCGTTAGGATTCATGACCGTTCTGCTTCGGAGATCAACTACCCCTCCTCTCTTCCGGCTGATGATAGAGGTCAAGAACCTCAGCC CGACGGTGATGACGATGATGACGATGACGACGATAACAGCGACTTCGAAATCTCTACCCGCGGTAAGTTGTTACAGTTTTTATCTTAA
AA sequence Show only first row Show all	>Lus10023520 pacid=23160632 polypeptide=Lus10023520 locus=Lus10023520.g ID=Lus10023520.BGIv1.0 annot-version=v1.0 MSSSGLPSNVRQGPLRFYKIVTNDSLRHRKLYLRDFTFSVRIHDRSASEINYPSSLPADDRGQEPQPDGDDDDDDDDDNSDFEISTRGKLLQFLS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10023520 [exp]	0	1
AT2G36190		ATCWINV4	cell wall invertase 4 (.1)		Lus10014217 [exp]	2.2	1.0000
AT5G14760		AO	L-aspartate oxidase (.1)		Lus10018901 [exp]	3.9	1.0000
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10027891 [exp]	4.7	1.0000
AT5G56790			Protein kinase superfamily pro...		Lus10000773 [exp]	7.4	1.0000
AT4G35500			Protein kinase superfamily pro...		Lus10016690 [exp]	7.5	1.0000
AT5G49900			Beta-glucosidase, GBA2 type fa...		Lus10023340 [exp]	8.1	1.0000
					Lus10015681 [exp]	8.4	1.0000
					Lus10024762 [exp]	8.4	1.0000
					Lus10012669 [exp]	8.5	1.0000
					Lus10010840 [exp]	8.8	1.0000

Compare expression of checked genes

Lus10023520 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.