Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000178 [exp] 213 / 7e-72 ND / Lus10040421 [exp] 149 / 6e-47 ND / Lus10019772 [exp] 150 / 3e-43 AT5G50400 287 / 2e-84 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 27, purple acid phosphatase 27 (.1) Lus10012947 [exp] 132 / 3e-41 ND / Lus10025569 [exp] 124 / 6e-35 AT5G06600 149 / 7e-39 ubiquitin-specific protease 12 (.1.2.3) Lus10029608 [exp] 115 / 1e-34 ND / Lus10017291 [exp] 119 / 3e-33 AT5G06600 100 / 3e-22 ubiquitin-specific protease 12 (.1.2.3) Lus10017290 [exp] 115 / 8e-33 ND / Lus10013548 [exp] 116 / 1e-32 AT5G06600 55 / 3e-08 ubiquitin-specific protease 12 (.1.2.3)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023536 pacid=23160493 polypeptide=Lus10023536 locus=Lus10023536.g ID=Lus10023536.BGIv1.0 annot-version=v1.0 ATGAGCAAGGATTTGGAGGGGAGGCTGGCTTACAGGAAAGGGAAACTGTCAACTTTGCAGGCAGAGGTTTCTAAACTTGTGGAAGAAGGCTTGAAGCTGG ATGTCGAAATTCAACAATTAACTGCTCGGAGGGCCAAAATTCTTGAACCCGTGAATTCTACTTCGGTGGAACTGGAGAAGGCTAACCAAGAGGCTTCCAA GGAACTGGATGAACTGAAGAAGGAAAGTAACGAGATTAATCAAGCAGGCAAAAAGCGGATGAGAGCCATGGAGGACCTTGCTCAGGCTAATGCAAGTTGG AAACTTTTCAAGAATTTAGGATGGAAATAG
AA sequence Show only first row Show all	>Lus10023536 pacid=23160493 polypeptide=Lus10023536 locus=Lus10023536.g ID=Lus10023536.BGIv1.0 annot-version=v1.0 MSKDLEGRLAYRKGKLSTLQAEVSKLVEEGLKLDVEIQQLTARRAKILEPVNSTSVELEKANQEASKELDELKKESNEINQAGKKRMRAMEDLAQANASW KLFKNLGWK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10023536 [exp]	0	1
AT4G10265			Wound-responsive family protei...		Lus10039760 [exp]	4.2	0.7661
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10014110 [exp]	6.3	0.7626
AT1G03940			HXXXD-type acyl-transferase fa...		Lus10012743 [exp]	12.9	0.8061
AT1G67623			F-box family protein (.1)		Lus10006434 [exp]	18.4	0.8057
					Lus10038704 [exp]	24.5	0.7996
AT1G57790			F-box family protein (.1)		Lus10004476 [exp]	26.3	0.8000
AT3G02750			Protein phosphatase 2C family ...		Lus10022683 [exp]	30.3	0.7927
AT3G02645			Plant protein of unknown funct...		Lus10023185 [exp]	32.8	0.7788
AT4G34770			SAUR-like auxin-responsive pro...		Lus10007564 [exp]	33.4	0.7878
AT4G15733		SCRL11	SCR-like 11 (.1)		Lus10029762 [exp]	44.0	0.7695

Compare expression of checked genes

Lus10023536 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.