Lus10023541 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47710 120 / 8e-32 Serine protease inhibitor (SERPIN) family protein (.1)
AT2G14540 108 / 3e-27 ATSRP2 serpin 2 (.1)
AT1G62170 104 / 1e-25 Serine protease inhibitor (SERPIN) family protein (.1), Serine protease inhibitor (SERPIN) family protein (.2)
AT2G25240 103 / 1e-25 Serine protease inhibitor (SERPIN) family protein (.1)
AT3G45220 100 / 3e-24 Serine protease inhibitor (SERPIN) family protein (.1)
AT2G26390 97 / 4e-23 Serine protease inhibitor (SERPIN) family protein (.1)
AT1G64030 95 / 2e-22 ATSRP3 serpin 3 (.1)
AT2G35580 92 / 1e-21 Serine protease inhibitor (SERPIN) family protein (.1)
AT1G51330 87 / 9e-21 Serine protease inhibitor (SERPIN) family protein (.1)
AT1G63280 84 / 2e-20 Serine protease inhibitor (SERPIN) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032754 140 / 2e-39 AT1G47710 487 / 1e-172 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10002792 137 / 3e-38 AT1G47710 495 / 6e-176 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10034364 91 / 9e-21 AT1G47710 296 / 4e-97 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10005089 89 / 3e-20 AT1G47710 306 / 2e-101 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10034362 86 / 3e-19 AT1G47710 274 / 1e-89 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10040426 87 / 4e-19 AT5G04310 380 / 8e-125 Pectin lyase-like superfamily protein (.1)
Lus10019009 54 / 3e-08 AT1G47710 209 / 9e-64 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10040926 53 / 3e-08 AT1G47710 115 / 2e-30 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10039336 52 / 2e-07 AT2G26390 105 / 2e-25 Serine protease inhibitor (SERPIN) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G036000 122 / 1e-32 AT1G47710 476 / 1e-168 Serine protease inhibitor (SERPIN) family protein (.1)
Potri.017G100900 92 / 2e-21 AT1G47710 337 / 2e-113 Serine protease inhibitor (SERPIN) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00079 Serpin Serpin (serine protease inhibitor)
Representative CDS sequence
>Lus10023541 pacid=23160614 polypeptide=Lus10023541 locus=Lus10023541.g ID=Lus10023541.BGIv1.0 annot-version=v1.0
ATGATGGACAAAAAGCCCAAGGTAAGGTCTGTGCCAACGTTCATTAATAGATGCAGAGAAACAAAGAAACATATACATGCAGGTATTCGGCTCGAAAAAA
GTTCGATTGAATCTCGTCTCGAACTTAAACGGCCAAGCTCGAACGGATCCTGCCTGGCTGCTTCTCGTAAAGTCGATTTCCAATCCAAGGCAGCTGAAGT
AGTTGTTGAAGTGAATGATTGGGCCAATAGACGGACGAACGGAATCGTAGAGGAAATTGTTCCTCGAGGGGCAGTTAACAACTTAACACCGCTAATTTAC
GCTAATGCGCTCTTCTTCGAAGGAGTTTGGAACCAGAATTTCGATGCATCGGCAACTAAACGCTATGATTTTCACCTACTGAATGATGGATCGGTCCGTG
TACCGTTTATGACCAGCGAAGAGGACCAGTATGTTTCCTTAACGAAGGAATTGGGGTTGGTCTTGCCTTTCTCTAACGAAGCAGACTTTACAGAGATGGT
GGAGGAATCTTCCGACGATGTGACTTTCTCCGAGGTATTCCACAAATCTTCTGTGGAAGTGAACGGAGAAGGTACGGAAGCTGGAGCTGCTTCTGTTACT
ATGATGGATATGTCGAGTCTGGGTGGATATGGGGAAATTTATAAACACTACTTTGTAGCGGATCATCCGGTCCTCTTCTTCATTAAAGAAGACACCACGG
GAACGGTTCTGTTCAGCGGAGACATCCTGGATCCATCGCTGCCTGCTTAG
AA sequence
>Lus10023541 pacid=23160614 polypeptide=Lus10023541 locus=Lus10023541.g ID=Lus10023541.BGIv1.0 annot-version=v1.0
MMDKKPKVRSVPTFINRCRETKKHIHAGIRLEKSSIESRLELKRPSSNGSCLAASRKVDFQSKAAEVVVEVNDWANRRTNGIVEEIVPRGAVNNLTPLIY
ANALFFEGVWNQNFDASATKRYDFHLLNDGSVRVPFMTSEEDQYVSLTKELGLVLPFSNEADFTEMVEESSDDVTFSEVFHKSSVEVNGEGTEAGAASVT
MMDMSSLGGYGEIYKHYFVADHPVLFFIKEDTTGTVLFSGDILDPSLPA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G62170 Serine protease inhibitor (SER... Lus10023541 0 1

Lus10023541 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.