Lus10023549 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G16370 133 / 5e-38 THY-1 thymidylate synthase 1 (.1)
AT4G34570 131 / 3e-37 THY-2 thymidylate synthase 2 (.1)
AT2G21550 107 / 1e-28 Bifunctional dihydrofolate reductase/thymidylate synthase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040434 170 / 1e-51 AT2G16370 799 / 0.0 thymidylate synthase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G157400 154 / 1e-45 AT2G16370 870 / 0.0 thymidylate synthase 1 (.1)
Potri.009G119200 150 / 3e-44 AT2G16370 845 / 0.0 thymidylate synthase 1 (.1)
Potri.005G230400 127 / 1e-37 AT2G16370 303 / 2e-100 thymidylate synthase 1 (.1)
Potri.005G230700 127 / 3e-37 AT2G16370 299 / 8e-99 thymidylate synthase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0387 DHFred PF00186 DHFR_1 Dihydrofolate reductase
Representative CDS sequence
>Lus10023549 pacid=23160636 polypeptide=Lus10023549 locus=Lus10023549.g ID=Lus10023549.BGIv1.0 annot-version=v1.0
ATGGCGAGTTCTGTAGCCAGCCTTTCCAATGGCGGTGTTGGTGGACAGCCAGATCCACAGAGGACTTACCAGGTTGTCGTGGCTGCAACTAAAGATTGGG
GTATCGGGAAAGATGGGAAGTTGTCTTGGAAGCTGCCTTCTGATCTCAAGTTCTTTAAAGATGTTTCCTTGACGACTTCCGATTCCGGGAAGAAGAATGC
AGTGGTCATGGGTAGGAAAACATGGGAGAGCATCCCACTTCAGCACCGTCCTCTCCCTGGACGTCTGAACTTGTTCTCACTCGATCGGGGAGCTTCAATA
TCGCTACTGCGGAGAATGTTGTGA
AA sequence
>Lus10023549 pacid=23160636 polypeptide=Lus10023549 locus=Lus10023549.g ID=Lus10023549.BGIv1.0 annot-version=v1.0
MASSVASLSNGGVGGQPDPQRTYQVVVAATKDWGIGKDGKLSWKLPSDLKFFKDVSLTTSDSGKKNAVVMGRKTWESIPLQHRPLPGRLNLFSLDRGASI
SLLRRML

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G16370 THY-1 thymidylate synthase 1 (.1) Lus10023549 0 1
AT2G45770 FRD4, CPFTSY FERRIC CHELATE REDUCTASE DEFEC... Lus10003676 2.0 0.8066
AT3G07610 IBM1 increase in bonsai methylation... Lus10002051 6.3 0.7993
AT5G64320 Pentatricopeptide repeat (PPR)... Lus10039056 6.6 0.7651
AT5G10710 unknown protein Lus10026943 7.6 0.7212
AT1G77800 PHD finger family protein (.1.... Lus10024778 8.5 0.7784
AT3G23590 MED33A, RFR1 REF4-related 1 (.1) Lus10041229 8.7 0.8170
AT4G30720 PDE327 PIGMENT DEFECTIVE 327, FAD/NAD... Lus10022174 18.9 0.7780
AT3G54460 SNF2 domain-containing protein... Lus10039526 19.7 0.7841
AT4G27340 Met-10+ like family protein (.... Lus10037871 21.2 0.7563
AT3G54980 Pentatricopeptide repeat (PPR)... Lus10019524 22.1 0.8063

Lus10023549 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.